PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G167600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 497aa    MW: 54199.1 Da    PI: 7.2862
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G167600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-39138198262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Potri.010G167600.1 138 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSSS 198
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31135195IPR003851Zinc finger, Dof-type
PfamPF027013.9E-32140196IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.705142196IPR003851Zinc finger, Dof-type
PROSITE patternPS013610144180IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSDLAIKLFG KTIPLQVNQL EGDVSCAINK HESSSGTPVA PPEPEEYCYT ATTCLHEKDK  60
EEQEGNHRES SGEEIANEKQ EDVTSCQITE DSKDPTSSGI SENPKTPSVE RETSSLKSSK  120
DEEQRETSIS QEKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK KCQRYWTAGG  180
TMRNVPVGAG RRKNKSSSAS HYRHLMVSEA LRTVQVHAMN GVHNPSFGNN TTVLAFGSDS  240
PLCDSVASVL NLSEKTQNSV RNEYHRPEHR IFVPCGGAGS NGDDRSSGSP ATASDSSEKG  300
CNGNSREAVN KDYQSFPPQV PCFPGPPWPY QWNSALPPPT FYPPGFPVSF YPAPTYWGCT  360
VPSPWNVPPC VSPPSTSLKH CTLDSSPTST LGKHSRDGSI LHPAYLKEPS REGTKSVKGV  420
LVPKTSRIDD PSEAAKSSIW ATLGIMSEKS NSINGGGLFK GFQSKNEDKN DMAGRTSVLQ  480
ANPAALSRSL NFHENN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G167600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2863040.0GU286304.1 Populus balsamifera isolate FBK13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863050.0GU286305.1 Populus balsamifera isolate FBK13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863060.0GU286306.1 Populus balsamifera isolate FRE01 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863070.0GU286307.1 Populus balsamifera isolate FRE01 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863080.0GU286308.1 Populus balsamifera isolate GIL14 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863090.0GU286309.1 Populus balsamifera isolate GIL14 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863100.0GU286310.1 Populus balsamifera isolate HAY07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863110.0GU286311.1 Populus balsamifera isolate HAY07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863120.0GU286312.1 Populus balsamifera isolate INU03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863130.0GU286313.1 Populus balsamifera isolate INU03 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863140.0GU286314.1 Populus balsamifera isolate KUU07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863150.0GU286315.1 Populus balsamifera isolate KUU07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863160.0GU286316.1 Populus balsamifera isolate MGR10 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863170.0GU286317.1 Populus balsamifera isolate MGR10 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863180.0GU286318.1 Populus balsamifera isolate POR11 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863190.0GU286319.1 Populus balsamifera isolate POR11 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863200.0GU286320.1 Populus balsamifera isolate RNA13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863210.0GU286321.1 Populus balsamifera isolate RNA13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863220.0GU286322.1 Populus balsamifera isolate WHR03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863230.0GU286323.1 Populus balsamifera isolate WHR03 haplotype B Dof zinc finger protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024465104.10.0cyclic dof factor 3
TrEMBLA0A2K1YVC80.0A0A2K1YVC8_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-81cycling DOF factor 3