PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G167300.5
Common NamePOPTR_0010s17450g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 345aa    MW: 38234.4 Da    PI: 7.2661
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G167300.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.74.7e-211053245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        + en+  rq tf+kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Potri.010G167300.5 10 KLENTNGRQATFAKRKHGIMKKANELSILCDIDIILLMFSPTGK 53
                        6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.983153IPR002100Transcription factor, MADS-box
SMARTSM004327.8E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-25294IPR002100Transcription factor, MADS-box
CDDcd002662.12E-26281No hitNo description
PRINTSPR004041.1E-16323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT FAKRKHGIMK KANELSILCD IDIILLMFSP TGKPSLCKGA  60
SSIEEVITKF AQLTPQERAK RKLESLEALK KTFKKLDHDV NIPEFLGTSS QTIEDLTSQS  120
RLLQNQLSDV HKRLSYWTNP DKINSIEHLG QLENSLRESL NQIRSCKFQN EMHVPFRMGA  180
EQQLSPLLWI PNNDSQHIML PEEQNLLPHR DAECTASTSF GSYSGYFGAG KNSELSSSGQ  240
ESGMNGILDE LNGTASLRLR LAGQYPYLPG PYNLNLLNDT KFQPAAEMNI QKGPGDFNVS  300
GSFEAPKPEY DSGPHGWAST SGSCAVTMFD DHLYAPVSFP SVLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-13191190MEF2 CHIMERA
6byy_B1e-13191190MEF2 CHIMERA
6byy_C1e-13191190MEF2 CHIMERA
6byy_D1e-13191190MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G167300.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024465773.10.0agamous-like MADS-box protein AGL30 isoform X4
SwissprotQ1PFA41e-113AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A3N7FRM80.0A0A3N7FRM8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17450.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-86AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]