PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G167300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 399aa    MW: 44589 Da    PI: 8.2153
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G167300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.45.7e-2163106245
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                         + en+  rq tf+kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Potri.010G167300.1  63 KLENTNGRQATFAKRKHGIMKKANELSILCDIDIILLMFSPTGK 106
                         6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.8E-2854113IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.98354106IPR002100Transcription factor, MADS-box
CDDcd002668.83E-2755135No hitNo description
SuperFamilySSF554557.98E-2555148IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-165676IPR002100Transcription factor, MADS-box
PfamPF003198.6E-1964107IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-167691IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-1691112IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MSCNPICKLV QNPFSLFPFV LSFSFLSLLF LVPTFKIPFH HPFFSPRLIC YFRMGRVKLK  60
IKKLENTNGR QATFAKRKHG IMKKANELSI LCDIDIILLM FSPTGKPSLC KGASSSIEEV  120
ITKFAQLTPQ ERAKRKLESL EALKKTFKKL DHDVNIPEFL GTSSQTIEDL TSQSRLLQNQ  180
LSDVHKRLSY WTNPDKINSI EHLGQLENSL RESLNQIRSC KFQNEMHVPF RMGAEQQLSP  240
LLWIPNNDSQ HIMLPEEQNL LPHRDAECTA STSFGSYSGY FGAGKNSELS SSGQESGMNG  300
ILDELNGTAS LRLRLAGQYP YLPGPYNLNL LNDTKFQPAA EMNIQKGPGD FNVSGSFEAP  360
KPEYDSGPHG WASTSGSCAV TMFDDHLYAP VSFPSVLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-1554145190MEF2 CHIMERA
6byy_B1e-1554145190MEF2 CHIMERA
6byy_C1e-1554145190MEF2 CHIMERA
6byy_D1e-1554145190MEF2 CHIMERA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G167300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024465772.10.0agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-113AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A2K1YVC70.0A0A2K1YVC7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Representative plantOGRP59461119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.27e-87AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]