PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G154300.1
Common NamePOPTR_0010s16400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 601aa    MW: 66182 Da    PI: 7.9715
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G154300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-41193268277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv +C++dls+ k+yh+rhkvCevh+k+p+v+v+g eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Potri.010G154300.1 193 CQVYDCNKDLSSSKDYHKRHKVCEVHTKTPQVIVNGNEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 268
                         **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.795190267IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.7E-32191254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-38192272IPR004333Transcription factor, SBP-box
PfamPF031102.9E-31193266IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MSFFFGLPRK VKGKIKFEEE SYTFVLLMDF WSYASEGKGL LFSDEIDLSG DAFTRSRKAS  60
IGCDTEAAES AESLDLGFSE IPRKPFHGSK TGAGMFGGSC VGIDSSKLVV GSPNCMIASN  120
SSMESRSNHS NSLMESNSQD SSLFDLKLGR LADCIDAQNS RFSKERFLLS SASPTTQAKR  180
APMASLRPRI SFCQVYDCNK DLSSSKDYHK RHKVCEVHTK TPQVIVNGNE QRFCQQCSRF  240
HLLVEFDDGK RSCRKRLAGH NERRRKPQFG TLSVKPHKLL HPFQSTKFLG TSLAKRTSFL  300
FPNMLPGGTF CPQSYEEDNW RKHVKLEENS IYSSPSAIPI RNGQLLPRSF LHLHGNRIQK  360
TCGISPLDTE DLTISNTATT INELAGVSHS SCALSLLSAA ESQDLSHSAG NIMVRPLVSQ  420
AGGACQTLGI ANKSLGGGSS EKYVPIGINS FGMNFIEVDN MGPFGVSGSG HAADLKVETD  480
GFLHHSDFLN AKHCVSPANE STVDWLQLSS HLQRVEQQRN SMKVKHENED FCSFGATYRC  540
TTLFLDEKVI NPALMQRREL VAICIPASNI ITNFIDAIDN EPLETSVSVC KYIPLLKGYI  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28190266884squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G154300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091030.0AC209103.1 Populus trichocarpa clone POP056-L16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024467054.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A3N7FN280.0A0A3N7FN28_POPTR; Uncharacterized protein
STRINGPOPTR_0010s16400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-46SBP family protein