PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G143700.1
Common NamePOPTR_0010s15370g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 589aa    MW: 66991.1 Da    PI: 5.7236
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G143700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.34.6e-922095792374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaalkl... 83 
                          elLl+ Ae v ++++e+a+++L+  ++l+s+  +p+qR+++yf eAL++r+ r++ ++    p +++++++      + +      l   
  Potri.010G143700.1 209 AELLLASAEKVGNQQFERANRFLNYCEHLSSNGESPVQRVVHYFSEALRERIDRETGRIT---PKWPEKSHSfdldraMMT------Lnpa 290
                         689***************************************************555555...444444444321222222......2334 PP

                GRAS  84 ...fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAe 170
                             ++  P+ +++h++  qaI+e v++++r+HiiD++i +G+QW  L+qaL s+ e+p   l+i ++gs   +ske +e tg+rL +fAe
  Potri.010G143700.1 291 ilaCYQNVPFSQVAHFAGIQAIVEKVNRAKRIHIIDLEIRNGVQWTVLMQALVSQHESPLeLLKISAIGS---TSKELIEDTGKRLMSFAE 378
                         5569999**********************************************998555449********...689*************** PP

                GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                         ++++pf+f+v++++++ dl+ + +++  +Ea+aV    +l +l     +l+++ d+++k++++++P++vvv+e ea+ ns+sF++rf+eal
  Potri.010G143700.1 379 TMNIPFSFKVVMVSDMLDLKKDLFELGAEEAVAVYAENSLRSLI----ALPNRLDSIMKVFRNINPRIVVVMEVEANNNSPSFVNRFIEAL 465
                         ****************************************9998....78888888*********************************** PP

                GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrv 351
                          +ysa fd+++a ++r+s +r+  E +++++ei+n+va+eg+er+ rh +l  Wr  + ++ + + +ls++   qa+lll+k++ +   ++
  Potri.010G143700.1 466 FFYSAYFDCFDACMGRDSPNRMIAESKYIRQEIRNIVATEGEERKIRHVKLDVWRTFFARFAMVETELSKSSLYQASLLLNKIArWSSCTL 556
                         ************************************************************************************8888*** PP

                GRAS 352 eeesgslvlgWkdrpLvsvSaWr 374
                         + +++slv+gWk+ p+ s+S+W+
  Potri.010G143700.1 557 DMNEKSLVIGWKGTPMHSLSVWK 579
                         **********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.347182558IPR005202Transcription factor GRAS
PfamPF035141.6E-89209579IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MFSFQDYSFD GIQDMLSSKS RSRESVEGVN TRKQSHFYGF EAEAGGDAYG FYQDVSTGEG  60
FFFSKYQNQE QKQQSYLDCG LLDDHSYNIL SPQLQTSLDG IEKLDEIPAV TQDGLQPWKE  120
NQYPFSLASL ELHGDRQFDG ERTVERSSGA PRAKVIGTEL STEEIMKMAG AKFIQSFSRM  180
VDTASMLNNP FDLFFSGLSE EAAKNVELAE LLLASAEKVG NQQFERANRF LNYCEHLSSN  240
GESPVQRVVH YFSEALRERI DRETGRITPK WPEKSHSFDL DRAMMTLNPA ILACYQNVPF  300
SQVAHFAGIQ AIVEKVNRAK RIHIIDLEIR NGVQWTVLMQ ALVSQHESPL ELLKISAIGS  360
TSKELIEDTG KRLMSFAETM NIPFSFKVVM VSDMLDLKKD LFELGAEEAV AVYAENSLRS  420
LIALPNRLDS IMKVFRNINP RIVVVMEVEA NNNSPSFVNR FIEALFFYSA YFDCFDACMG  480
RDSPNRMIAE SKYIRQEIRN IVATEGEERK IRHVKLDVWR TFFARFAMVE TELSKSSLYQ  540
ASLLLNKIAR WSSCTLDMNE KSLVIGWKGT PMHSLSVWKF DKNRKGLK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3723857933375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495420.0AC149542.1 Populus trichocarpa clone Pop1-2C5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316034.10.0hypothetical protein POPTR_0010s15370g
TrEMBLB9HX040.0B9HX04_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-51RGA-like 1