PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G143600.1
Common NamePOPTR_0010s15360g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 562aa    MW: 63616.5 Da    PI: 4.6467
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G143600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.41.5e-901875563374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsPil 91 
                         e +l+ Ae v +++   a++lL++   l+s++g+p+qR++ yf eAL++r+ r +++  +++l++   + ++ +     + ++ +e  P++
  Potri.010G143600.1 187 ECMLASAEKVGNQQYDSARRLLNQCDLLSSNTGNPVQRVVYYFSEALRKRIDReTGKVASESLESDLFDVYEaVMIPNPIIQACYEGIPFY 277
                         567889999********************************************3444444555555555443322233345779******* PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                         ++ h++  qaIle +++++r+H+iD+ is+GlQW  L++aLasR+e p   l+iT+vg    +sk+ +e tg+rL++fA+++++pf+f+++
  Potri.010G143600.1 278 QVPHFAGTQAILENMAEAKRIHVIDLKISNGLQWTVLMHALASRNECPLeLLKITAVGT---NSKQHIEDTGNRLKSFAQTTNIPFSFKIV 365
                         *********************************************7665499*******...589************************** PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +++++ dl+ + ++++ +E laV + ++l++l  ++ +l +    ++++++s++P v+v++e ea+hns  F++rf+e+l y+sa fd+++
  Potri.010G143600.1 366 MVSSMLDLKEDLFELDADEQLAVYSEYALKSLIVQPNQLGH----LMEVFRSINPCVLVMIEIEANHNSRVFVHRFIETLFYFSAYFDCVD 452
                         ********************************977777766....********************************************** PP

                GRAS 273 aklpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         a l +++ + r+ +E  +lg+ i+n+va eg+er+ r+ +   Wr+ l ++G+ + +lse    qa+ +++k++ +   + + + +sl++g
  Potri.010G143600.1 453 ACLEHNDpSSRMIIESIYLGEGIRNIVASEGEERKIRNVKIDVWRKFLAQFGMVETELSEASLHQANFVIKKFAfGSCCTFDTDGKSLLIG 543
                         ***999999*****************************************************************88889************ PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+ p++s+S W+
  Potri.010G143600.1 544 WKGTPILSLSTWK 556
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.834159535IPR005202Transcription factor GRAS
PfamPF035145.2E-88187556IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MEGMNRGKYE PDGWEEFGTG SNDCFSSDYV LPHKDSSEGG CRSSKFEQLE QQKEPFLDYR  60
QFEDLELDVL CPLLPACPNQ IAMLREIQEE IEDIVAPKMQ NERPFSLSTL ELLKDYTKGR  120
RRLNVEPSDA NLAGQKLSTE EIMRFAGVKF IQSSIQMAGV GSLLKYPYDL SFSGLSDEET  180
KNVELAECML ASAEKVGNQQ YDSARRLLNQ CDLLSSNTGN PVQRVVYYFS EALRKRIDRE  240
TGKVASESLE SDLFDVYEAV MIPNPIIQAC YEGIPFYQVP HFAGTQAILE NMAEAKRIHV  300
IDLKISNGLQ WTVLMHALAS RNECPLELLK ITAVGTNSKQ HIEDTGNRLK SFAQTTNIPF  360
SFKIVMVSSM LDLKEDLFEL DADEQLAVYS EYALKSLIVQ PNQLGHLMEV FRSINPCVLV  420
MIEIEANHNS RVFVHRFIET LFYFSAYFDC VDACLEHNDP SSRMIIESIY LGEGIRNIVA  480
SEGEERKIRN VKIDVWRKFL AQFGMVETEL SEASLHQANF VIKKFAFGSC CTFDTDGKSL  540
LIGWKGTPIL SLSTWKFMSQ D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3621555633375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495420.0AC149542.1 Populus trichocarpa clone Pop1-2C5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316033.10.0hypothetical protein POPTR_0010s15360g
TrEMBLB9HWZ80.0B9HWZ8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-60RGA-like 2