PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G143500.1
Common NamePOPTR_0010s15350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 550aa    MW: 62424 Da    PI: 4.8511
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G143500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS275.22e-841815472374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevs 88 
                          elL++ Ae +s+++++ a++lL     l+s++g+p+qRl+ yf +AL++r+++++ +     + ++    n  e+++  +l    f++  
  Potri.010G143500.1 181 AELLFSSAEKLSNQQFNSASRLLDLCDFLSSNTGNPVQRLVYYFSRALRERINQETRRST--SKEQSF---NIYEAIMTPSLsnmaFYKQN 266
                         689**************************************************9322222..222223...344444444444446***** PP

                GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                         P+ ++sh++  qaI+e + +++r+HiiD++i  GlQW  ++qaL s++  +   l+iT++g    +sk+ +e tg+rL +fA+++++p +f
  Potri.010G143500.1 267 PFNQVSHFAGIQAIVENTIESKRIHIIDLEIRSGLQWTIFMQALVSQEaWPLELLKITAIGT---TSKQLIEDTGKRLLSFAQTMNLPCSF 354
                         *********************************************999455569********...689*********************** PP

                GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                         nv++++++ dl+ ++++++ +E++aV + + l +l +++  l+s    ++k++++++P+v+v++e ea+hns+ F++rf+e+l y sa+fd
  Potri.010G143500.1 355 NVVMVSDILDLREDHFQLDDEETVAVFSEFYLASLIASPNRLDS----LMKVIRNINPRVMVIIEVEANHNSPVFVDRFVETLFYLSAFFD 441
                         ***********************************966665555....******************************************* PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                         +l++ + r++ +r+  E  ++g+ i++++ +eg+er+ r+ +   Wr+ + ++ + ++++s + ++qa+ + +k + ++  +++ + +sl+
  Potri.010G143500.1 442 CLDTCMERDDPNRVISESIYFGEGIRKILVAEGEERNIRNVKIDVWRACFARFEMVEAEMSMSSTCQANIMAKKLAcGKACTLNMDGKSLI 532
                         ****************************************************************************9999*********** PP

                GRAS 360 lgWkdrpLvsvSaWr 374
                         +gWk+ p+  +S+W+
  Potri.010G143500.1 533 IGWKGTPIHCLSVWK 547
                         **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.766154526IPR005202Transcription factor GRAS
PfamPF035147.1E-82181547IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MANESFFLEE SNFGEVQDAF NSTHKSFDSK EGEKTQEIRF FGADEELGQS WSNDPQSSFM  60
SPPLETCLEE ISKLRGIESG IGDLLEHNKE KQLPFSLASL QLLQKYGNGL KRLNDIERRI  120
EPNIDPSTPK VKKQELSTEE IMKIAGARFI QSSNTDVHFN HPFDLSFSSL SASEAKNMEL  180
AELLFSSAEK LSNQQFNSAS RLLDLCDFLS SNTGNPVQRL VYYFSRALRE RINQETRRST  240
SKEQSFNIYE AIMTPSLSNM AFYKQNPFNQ VSHFAGIQAI VENTIESKRI HIIDLEIRSG  300
LQWTIFMQAL VSQEAWPLEL LKITAIGTTS KQLIEDTGKR LLSFAQTMNL PCSFNVVMVS  360
DILDLREDHF QLDDEETVAV FSEFYLASLI ASPNRLDSLM KVIRNINPRV MVIIEVEANH  420
NSPVFVDRFV ETLFYLSAFF DCLDTCMERD DPNRVISESI YFGEGIRKIL VAEGEERNIR  480
NVKIDVWRAC FARFEMVEAE MSMSSTCQAN IMAKKLACGK ACTLNMDGKS LIIGWKGTPI  540
HCLSVWKFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3221054733375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495420.0AC149542.1 Populus trichocarpa clone Pop1-2C5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316032.10.0hypothetical protein POPTR_0010s15350g
TrEMBLB9HWZ70.0B9HWZ7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-52RGA-like 2