PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G143400.1
Common NamePOPTR_0010s15340g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 490aa    MW: 54885.3 Da    PI: 5.4085
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G143400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.55.5e-901174871374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsP 89 
                         l++ L+++Ae v ++++  ++++L+   +++s +g+p+qR++ yft AL++r+ r++ ++      + +s+ +  +++   a    ++  P
  Potri.010G143400.1 117 LIQFLIAAAEKVGQQQFDHVSEMLSMCDQMSSATGNPVQRIVYYFTGALRERIDRETGKITPRGLFTISSNVEeaMVSLSPAILECHQRMP 207
                         5789***************************************************6666665443333332221134444444449999** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                         + ++++lt  qaI+e+++ ++r+H+iD+ i  G+QW+aL+qaLa+R+  ++  l+iT++g    +s  +++etg+rLa+fAe++++pf+fn
  Potri.010G143400.1 208 FCQIAQLTGIQAIVESAADAKRLHVIDLKIDSGVQWIALMQALAARNdCPTELLKITAFGT---TSMSKIQETGKRLAQFAETVNLPFSFN 295
                         ***********************************************4455599*******...689************************ PP

                GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         ++++ +++dl+ e+++++ gE +aV ++l l++ll+++ +les    +++++++l+P+++v++e ea+hns+ F +rf+e+l y+sa+fd+
  Potri.010G143400.1 296 LVMVLNINDLKKESFDIEAGEFIAVYSSLFLKNLLAQPKCLES----LMRVIRDLRPEIMVITEPEANHNSQAFKDRFVETLLYFSAIFDC 382
                         **999*************************************9....******************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvl 360
                         lea + r +  r+  E  +l+ +i+n +a+eg+er+ ++ +   Wr+ l e+G+++ +ls +   qa  +++k++ +   +++ + ++l++
  Potri.010G143400.1 383 LEACMDRSDPSRMGAEGLYLSYAIKNSIAKEGKERTFECVKIDYWRAYLAEFGMEETELSMTSLYQAIQVVKKFAcGSYCTLDMNGKCLII 473
                         ***************************************************************************8777899999****** PP

                GRAS 361 gWkdrpLvsvSaWr 374
                         gWk+ p+ s+S+W+
  Potri.010G143400.1 474 GWKGTPINSLSVWK 487
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.47991466IPR005202Transcription factor GRAS
PfamPF035141.9E-87117487IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MGFHCPGLET KGKSYLKPQS LGEGKDNQAS FSLEAFQVLK QYEKRVKHLN KEKLEEPSNI  60
IERNSADVLA LSTEEIIKVA TETSLEYHLQ RSDNLSSLSF GCAPFVLTSD GVKYVELIQF  120
LIAAAEKVGQ QQFDHVSEML SMCDQMSSAT GNPVQRIVYY FTGALRERID RETGKITPRG  180
LFTISSNVEE AMVSLSPAIL ECHQRMPFCQ IAQLTGIQAI VESAADAKRL HVIDLKIDSG  240
VQWIALMQAL AARNDCPTEL LKITAFGTTS MSKIQETGKR LAQFAETVNL PFSFNLVMVL  300
NINDLKKESF DIEAGEFIAV YSSLFLKNLL AQPKCLESLM RVIRDLRPEI MVITEPEANH  360
NSQAFKDRFV ETLLYFSAIF DCLEACMDRS DPSRMGAEGL YLSYAIKNSI AKEGKERTFE  420
CVKIDYWRAY LAEFGMEETE LSMTSLYQAI QVVKKFACGS YCTLDMNGKC LIIGWKGTPI  480
NSLSVWKFC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3614048726375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495420.0AC149542.1 Populus trichocarpa clone Pop1-2C5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316031.20.0hypothetical protein POPTR_0010s15340g
TrEMBLB9HWZ60.0B9HWZ6_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15340.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-62RGA-like 1