PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G143200.1
Common NamePOPTR_0010s15330g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 447aa    MW: 50267.2 Da    PI: 7.0789
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G143200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS254.93e-78604284374
                GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl...fsevs.. 88 
                         lLl+ A+ ++++++ +a++ L+    l+s++g+++qR+++yf++AL +r+ r+   +   l+  e++ +  + ee +a++l   +  +s  
  Potri.010G143200.1  60 LLLASADKIENQQFDNASKSLNLCGFLSSKRGNSVQRVVHYFAKALGERIERKIGVVT--LTGMESKGQLlHLEE-TAVTLnpaLIACSlr 147
                         899*************************************************443333..333333333322222.222223455554444 PP

                GRAS  89 .PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                          P+ ++s+++  qa++e + ++++vH iD+ i  G++ + L+qaLa+R e p   l+iT+vg    +s++++ee g +L+ fAe+l +pf+
  Potri.010G143200.1 148 qPYSQVSQFAGIQAVVERLTSAKKVHFIDLAIRSGGHCIVLMQALANRHERPVeLLKITAVGT---TSEQKMEEAGVKLSCFAETLSLPFS 235
                         4************************************************6665499*******...68*********************** PP

                GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                         f++++ ++++dl+ ++++++ gE++a+ + ++l ++  +++++es    +L ++++l+P+v+v++e ea+h  + F +rfleal +ysa++
  Potri.010G143200.1 236 FKAITIENIKDLKEDMFELSDGEVVAIFSRIMLRTIKPHPGCMES----LLGVLRNLNPRVMVITEFEANHCLPIFIDRFLEALFFYSAFY 322
                         *************************************9*****99....****************************************** PP

                GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                         d+le ++ + +  r+++E+  lg+ei+++va+e ++r  +h +   Wr+ + + G+ + +ls++   qa+l+l++++ ++  +++ + ++l
  Potri.010G143200.1 323 DCLEFNMDPCDPYRMTLEAC-LGQEIRDIVAAEDDKRMFQHLKIDGWRANFAKLGMVEEELSTSSFYQAELVLQNFAsGNLCTLDRNGKCL 412
                         *****************987.********************************************************8888********** PP

                GRAS 359 vlgWkdrpLvsvSaWr 374
                         + gW++ p++svSaWr
  Potri.010G143200.1 413 ITGWRGTPILSVSAWR 428
                         ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.71531407IPR005202Transcription factor GRAS
PfamPF035141.0E-7560428IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MVPDSRLSTE EVMRVARARF IQISCQQHID LSLLNHFFDG HVAQFGSSGM EIKDMELALL  60
LLASADKIEN QQFDNASKSL NLCGFLSSKR GNSVQRVVHY FAKALGERIE RKIGVVTLTG  120
MESKGQLLHL EETAVTLNPA LIACSLRQPY SQVSQFAGIQ AVVERLTSAK KVHFIDLAIR  180
SGGHCIVLMQ ALANRHERPV ELLKITAVGT TSEQKMEEAG VKLSCFAETL SLPFSFKAIT  240
IENIKDLKED MFELSDGEVV AIFSRIMLRT IKPHPGCMES LLGVLRNLNP RVMVITEFEA  300
NHCLPIFIDR FLEALFFYSA FYDCLEFNMD PCDPYRMTLE ACLGQEIRDI VAAEDDKRMF  360
QHLKIDGWRA NFAKLGMVEE ELSTSSFYQA ELVLQNFASG NLCTLDRNGK CLITGWRGTP  420
ILSVSAWRFH QQEQKRKGCT KKYKSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-258742833375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495420.0AC149542.1 Populus trichocarpa clone Pop1-2C5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316030.20.0hypothetical protein POPTR_0010s15330g
TrEMBLB9HWZ50.0B9HWZ5_POPTR; Uncharacterized protein
STRINGPOPTR_0010s15330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-59RGA-like 1