PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G128900.1
Common NamePOPTR_0010s13900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 391aa    MW: 42886 Da    PI: 7.541
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G128900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31224279156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++ ++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Potri.010G128900.1 224 KQRRCWSPELHRRFLHSLQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.534221281IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-28221282IPR009057Homeodomain-like
SuperFamilySSF466895.98E-18222282IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-26224279IPR006447Myb domain, plants
PfamPF002495.5E-6226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MDFAEKMQRC HEYVEALEEE RRKIQVFERE LPLCLELVTQ AIEACKRELS GTTEDHNMHG  60
QSECSEQTSS EGPVLEEFIP IKRTHSSDDE ENDNNHDDDD HQEQQSQNDN KRNKSNSSIS  120
NNDHKKKSDW LRSVQLWNQS PDPPQKQDLP RKAAVTEVKR NGAGGAFQPF HREKSVGKSS  180
NQAISKAPPS VPASATSSIA GAVTGGTGGG GNKKEDKEKG NQRKQRRCWS PELHRRFLHS  240
LQQLGGSHAA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPSPTIHTN SSQQAPQFVV  300
VGGIWVPPTE YAAVAATTTA GETSTISAAN GIYAPIAAPP PAVPQNRQHK QSEHSQSEGR  360
GSHGERGGAH SNNSPATSSS THTTTTSPVF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-12224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-12224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-12224277154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-12224277154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G128900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315957.10.0transcription factor HHO3 isoform X1
SwissprotQ9FPE81e-112HHO3_ARATH; Transcription factor HHO3
TrEMBLB9HWL50.0B9HWL5_POPTR; Uncharacterized protein
STRINGPOPTR_0010s13900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Representative plantOGRP54151221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-92G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]