PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G119000.1
Common NamePOPTR_0010s12900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 296aa    MW: 33025 Da    PI: 4.8428
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G119000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like43.28.7e-14241290151
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                         +prl W+++L  +F++a++ L G +kA P +ile m+v++L+  +v S LQ
  Potri.010G119000.1 241 RPRLIWNQDLQLKFMSAISAL-GDKKARPEKILEKMDVPCLSQRQVSSRLQ 290
                         59*******************.9***************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-13239290IPR009057Homeodomain-like
SuperFamilySSF466893.76E-8239291IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-12242291IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MKAGASLCLD KPISLYDLKY LWQYVFEKTT ICRVKVNFRK ISQGIVVKDE GGETEVPDGI  60
VLDGAAGYQN DTAPSSKGNG QVVGFEDLDA TNRQQTMAGL EVEVEEDGAS RLQMKADPKG  120
KANDSVEDTR EEKWSEQVAV MKENFTKDAE STAIEMSVLA EIQEQDESVI TRSQQQSGSK  180
RPTDGDEGRR NKERRVEANS EIISSGTKIN LEKQKEIEGN KGEGTERFKK YINTDSSTEK  240
RPRLIWNQDL QLKFMSAISA LGDKKARPEK ILEKMDVPCL SQRQVSSRLQ VEYSV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G119000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024466462.11e-99two-component response regulator ORR21
TrEMBLA0A2K1YSQ00.0A0A2K1YSQ0_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3923222
Representative plantOGRP8222311
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-13response regulator 2