PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G111400.1
Common NamePOPTR_0010s12150g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 317aa    MW: 35705.7 Da    PI: 8.3624
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G111400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.7e-2065126157
                         TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r++R+++t+eql +Lee +    r+p+++++++++++l    +++ ++V++WFqN++a+e++
  Potri.010G111400.1  65 RSSRWNPTAEQLLALEEKYSCgVRTPTTNQIQQITSELrrfgKIEGKNVFYWFQNHKARERQ 126
                         689*****************99**************************************97 PP

2Wus_type_Homeobox107.58.1e-3565128265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ++RW+Pt+eQ+  Lee y++G+rtP++++iq+it+eL+++Gkie+kNVfyWFQN+kaRerqk+
  Potri.010G111400.1  65 RSSRWNPTAEQLLALEEKYSCGVRTPTTNQIQQITSELRRFGKIEGKNVFYWFQNHKARERQKH 128
                         579***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.2462127IPR001356Homeobox domain
SuperFamilySSF466897.45E-1164133IPR009057Homeodomain-like
SMARTSM003891.3E-464131IPR001356Homeobox domain
CDDcd000861.86E-465128No hitNo description
PfamPF000461.7E-1765126IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-767126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MWMINGGDSN EPSMNDFFNP KPNTTTLCTY TTATPLTYVG LKHHLAKTSE QSRGRKLKEQ  60
AEATRSSRWN PTAEQLLALE EKYSCGVRTP TTNQIQQITS ELRRFGKIEG KNVFYWFQNH  120
KARERQKHRQ VQQKHNNTDH ESSNKMKESG PRRTVLGVDQ TNNLAPHSKC STDHVEGPVS  180
VNGAAIAESG THGWSEFEER ELQQMKSISL DMHAMWQTMD LSSSTPVHRL TSTMTTTASK  240
FSSLEEHSSL LRPTKTATHA NHDGEIREVQ TLQLFPLCSD DGNGANGTNN DRNVPIRTIN  300
TTFTPSQFFE FLPLKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G111400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827070.0KF982707.1 Populus tomentosa WOX6 (WOX6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314802.10.0WUSCHEL-related homeobox 6
TrEMBLB9HW560.0B9HW56_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Representative plantOGRP8416716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-28WUSCHEL related homeobox 1