PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G110700.1
Common NamePOPTR_0010s12080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 603aa    MW: 66310.7 Da    PI: 5.9978
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G110700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS460.78.6e-1412325911374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         lv+lL++cAeav++++l+la+al++++  la +++ +m+++a+yf+eALa+r+++        l p+++++++ s+ l++   f+e++P+l
  Potri.010G110700.1 232 LVHLLMACAEAVQENNLNLAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYK--------LYPQNSTDHSLSDILQI--HFYETCPYL 312
                         68*****************************************************........66777776667777666..4******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kf+h+taNqaIlea+eg++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+++++++l+e+g++La++Ae+++v+fe++ +v
  Potri.010G110700.1 313 KFAHFTANQAILEAFEGKKRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPAHDNTDQLQEVGWKLAQLAETIHVEFEYRGFV 403
                         ******************************************************************************************* PP

                GRAS 183 akrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         a++l+dl+ ++L+++p   E++aVn++++ h+ll+ ++++++    vL++vk+++P++v+vveqea+hn++ Fl+rf+e+l+yys+lfdsl
  Potri.010G110700.1 404 ANSLADLDASMLELRPteFESVAVNSIFEFHKLLAIPGAMKK----VLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSL 490
                         ****************8889**************99999999....********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e ++   s +++++++++l+++i+nvvaceg++r+erhetl +Wr rl++aGF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lg
  Potri.010G110700.1 491 EGSV---STQDKVMSEVYLAKQICNVVACEGSSRVERHETLTQWRTRLSSAGFAPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLG 578
                         ***7...9999******************************************************************************** PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++rpL+++SaWr
  Potri.010G110700.1 579 WHTRPLIATSAWR 591
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.3E-3755128No hitNo description
PfamPF120411.7E-3755122IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.425206570IPR005202Transcription factor GRAS
PfamPF035143.0E-138232591IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MKREHSNLHP QQLTNPSSLA AGGYSLTSTG TMTSNNGKAK TWEEEKGRQA DGGMDELLAV  60
LGYKVRSSDM AEVAQKLEQL EEVMGHAQED GLSHLASDSV HYNPSDLSTW LESMLSELNP  120
NHHFDLSADS LLAPAESSTV TSIDFTDRKH HQQPKLFEES SSSEYDLKVI PGKAVFSPTQ  180
IDSRESKRLK TDLYQTSSSP SSSSTTLGSL VASTESTRPV VLVDSQENGV RLVHLLMACA  240
EAVQENNLNL AEALVKQIGF LAVSQAGAMR KVATYFAEAL ARRIYKLYPQ NSTDHSLSDI  300
LQIHFYETCP YLKFAHFTAN QAILEAFEGK KRVHVIDFSM NQGMQWPALM QALALRPGGP  360
PAFRLTGIGP PAHDNTDQLQ EVGWKLAQLA ETIHVEFEYR GFVANSLADL DASMLELRPT  420
EFESVAVNSI FEFHKLLAIP GAMKKVLSVV KQMKPEIVTV VEQEANHNGP VFLDRFTESL  480
HYYSTLFDSL EGSVSTQDKV MSEVYLAKQI CNVVACEGSS RVERHETLTQ WRTRLSSAGF  540
APVHLGSNAF KQASMLLALF AGGDGYRVEE NNGCLMLGWH TRPLIATSAW RVNNHHPVGG  600
AA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-512325914375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1024710.0JX102471.1 Populus tomentosa DELLA domain GRAS family transcription factor GAI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314799.20.0hypothetical protein POPTR_0010s12080g
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLB9HW490.0B9HW49_POPTR; Uncharacterized protein
STRINGPOPTR_0010s12080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein
Publications ? help Back to Top
  1. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]