PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G105600.1
Common NamePOPTR_0010s11600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 664aa    MW: 72107.6 Da    PI: 6.2043
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G105600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53e-28224277155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Potri.010G105600.1 224 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 277
                         79*******************.********************************8 PP

2Response_reg75.22.5e-25401481109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+ + ++ll+++l +  y +v++++++++al+ll+e++  +D++l D+ mp+mdG++ll+     e++lp+i+++a g  + + + 
  Potri.010G105600.1  40 VLVVDDDITCLRLLEKMLCRCLY-NVTTCSQATAALKLLRERKgcFDVVLSDVHMPDMDGFKLLELVGL-EMDLPVIMMSADGRTSAVMRG 128
                         89*********************.****************************************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ +eel +
  Potri.010G105600.1 129 IRHGACDYLIKPIREEELKN 148
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.35E-3537166IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.5E-4237171No hitNo description
SMARTSM004481.0E-2838150IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.89339154IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-2240148IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.54E-2741154No hitNo description
Gene3DG3DSA:1.10.10.606.0E-30221282IPR009057Homeodomain-like
PROSITE profilePS5129410.898221280IPR017930Myb domain
SuperFamilySSF466891.79E-19222281IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-24224277IPR006447Myb domain, plants
PfamPF002499.5E-7226275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MAALQRVASS LSTSASSYGS CKGAGADLMF SDQFPAGLRV LVVDDDITCL RLLEKMLCRC  60
LYNVTTCSQA TAALKLLRER KGCFDVVLSD VHMPDMDGFK LLELVGLEMD LPVIMMSADG  120
RTSAVMRGIR HGACDYLIKP IREEELKNIW QHVIRKKWNE NKEQEHSGSF EDNDWYKRGN  180
DDTENASSVN EGAEGVLKGQ KKRNIAKEED DNELEIDDPS ASKKPRVVWS VELHQQFVSA  240
VNQLGIDKAV PKRILELMNV PGLTRENVAS HLQKFRLYLK RLSGVAQQGG ISNTFCGPLD  300
SNVKVNPLGR FDIQALAASS QIPPQTLAAL HAELFGRPTG SLVTTVDQPA LLQASMQGPK  360
CIPVEHGVAF GQPLVKCQTN ISKHFPRNVI SVEDVASGFG AWPSNSVGTV GSSSNLGGMN  420
SQNSNMLMDI LQQQKQQQQP LQQSSLSEPS RSINVQPSCL VVPSQSPATF QAGNSPASVD  480
QNCSYNRSTM IDYSLLSAQS NNSSLNIGQI LNGDLKTTGV SGYSGSVSIS PLSPCSVDPD  540
NTSQQGRSST MAIRAVRQLP GLVPNISNLQ GSYSARSSEV LDQRPLRNLG FVAKCTSIPS  600
RLAVDEFEST MSSLDHEKSY MEISGNKVKQ EPNIEYMDNA RVGIPILQQL PPAPSDLMSV  660
FTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23220283164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G105600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081410.0FN908141.1 Populus x canadensis mRNA for putative B-type response regulator 16 (rr16 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315852.10.0two-component response regulator ORR21 isoform X1
SwissprotQ8H7S71e-171ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLB9HVU50.0B9HVU5_POPTR; Uncharacterized protein
STRINGPOPTR_0010s11600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118082433
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-123response regulator 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]