PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G099600.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 208aa    MW: 23714.8 Da    PI: 8.1367
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G099600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-331972255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtpeLH++Fv+a+e+LGG++kAtPk +l++m+vkgLt++hvkSHLQ+YR+
  Potri.010G099600.3 19 PRLRWTPELHHCFVHAIERLGGQDKATPKLVLQMMDVKGLTISHVKSHLQMYRS 72
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-321574IPR009057Homeodomain-like
PROSITE profilePS5129412.251575IPR017930Myb domain
SuperFamilySSF466892.33E-161773IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-241972IPR006447Myb domain, plants
PfamPF002491.8E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGSCGRSGAV RQYVRSKVPR LRWTPELHHC FVHAIERLGG QDKATPKLVL QMMDVKGLTI  60
SHVKSHLQMY RSMRSGDLGR LDRSSTQQKR QSFAVYNECV EEVKAIEESD SHSMYRPLSS  120
KRARIETRSS LSEEFLQCSQ GICETISNPY SFDDYAGIKE EVNGVGFKWE QTHSNPQCTA  180
FSLPHDLYNF NPLKREVEES DFLKVGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-192074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-192074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.121900.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G099600.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024465798.11e-153putative Myb family transcription factor At1g14600
TrEMBLA0A2K1YRP71e-152A0A2K1YRP7_POPTR; Uncharacterized protein
STRINGXP_002521884.11e-111(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-37G2-like family protein