PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G092500.1
Common NamePOPTR_0010s10260g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Whirly
Protein Properties Length: 272aa    MW: 30192.8 Da    PI: 9.7934
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G092500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly204.11.7e-63922301139
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         s+yk+kaal++++++p+f+ l+sg+ kl ++G++l ++a+a + r+ydW +kq+f+ls+te+++lv+l++++sceffhdp ++ s+eGkvr
  Potri.010G092500.1  92 SIYKGKAALTIEPRAPEFSPLESGAYKLVKEGFVLSQFAPASSARQYDWTRKQVFSLSVTEIGHLVSLGARDSCEFFHDPNKGRSEEGKVR 182
                         7****************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                         k+lkvePlpdGsG+f+nlsv+n+ ++ +es+++Pv++ae++vl+s+++
  Potri.010G092500.1 183 KVLKVEPLPDGSGHFFNLSVQNKALNIDESIYIPVTRAEYTVLISAFN 230
                         *********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.0E-7581248IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.02E-7185271IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.5E-5893227IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MLQLNSVSWL SSTTQNPMLW LPQSNSQSSQ DSSAFSSISN SKTSNTKKKK KLSVKYQYYD  60
HQQKSFTSSS RPSSSSAPPV GESPPKVFVG HSIYKGKAAL TIEPRAPEFS PLESGAYKLV  120
KEGFVLSQFA PASSARQYDW TRKQVFSLSV TEIGHLVSLG ARDSCEFFHD PNKGRSEEGK  180
VRKVLKVEPL PDGSGHFFNL SVQNKALNID ESIYIPVTRA EYTVLISAFN YILPYLLGWH  240
AYANANSIKS ADSSRENNVN PRYGGDYDWN R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1078127032219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1078127032219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1078127032219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1078127032219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315793.20.0hypothetical protein POPTR_0010s10260g
SwissprotQ9M9S31e-110WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLB9HV940.0B9HV94_POPTR; Uncharacterized protein
STRINGPOPTR_0010s10260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23161635
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-107ssDNA-binding transcriptional regulator