PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G083400.2
Common NamePOPTR_0010s09350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CPP
Protein Properties Length: 738aa    MW: 80931.7 Da    PI: 6.4444
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G083400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR512.9e-16439477240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  Potri.010G083400.2 439 ACKRCNCKKSKCLKLYCECFAAGVYCIEPCACQDCFNKP 477
                         589**********************************96 PP

2TCR50.73.6e-16524562139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Potri.010G083400.2 524 RHKRGCNCKKSTCLKKYCECYQGGVGCSINCRCEGCKNV 562
                         589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-18438479IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.252439564IPR005172CRC domain
PfamPF036381.1E-11441476IPR005172CRC domain
SMARTSM011142.8E-18524565IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11526561IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 738 aa     Download sequence    Send to blast
MIFCYWLQDS PVFNYINSLS PIKPVKSINI AQTFHSLSFA SLPSVFTSPH VSSHKETRFL  60
KRHNYSDLSK PEFSSGNGNE VCKDEGVVVD AAQLYDNSAE LQENFDPGMS IGESSVEPPS  120
EHLKFATELP QTLKYGCGSP DSRCGTQTDM VSESAGTSLS LVPFANEASH KSFLESKKEA  180
TECDWESLIS DAADLLIFNS PIDADGFKEL FQKSPNPVVG FCTSFNEVHK TQIVNPFGSG  240
EQNEMGDPST QPGETIELTQ MDPTQDNLAA NEDPNKYMIS NASKAVSNLH RGMRRRCLDF  300
EKVGSRRKNM DDGSSSSSVL VQLDEKTTPK NTQLVPVKPG GDSSRCILPG IGLHLNALAI  360
NSKDSKKIKL ETFSSSITLP GSAASFNSRT TDQELDESLT LVSSERDNDP NENVVPLVED  420
FSQTSPKKKR RRLEGEPEAC KRCNCKKSKC LKLYCECFAA GVYCIEPCAC QDCFNKPIHE  480
DTVLATRKQI ESRNPLAFAP KVIRSSESAP EIRDESIKTP ASARHKRGCN CKKSTCLKKY  540
CECYQGGVGC SINCRCEGCK NVFGRKDDFP NSGAASMEME DEPEDETEAS VKNGVDKILQ  600
KTEIQNNDEQ NPNSALPTTP LRFCRPLVQF SSKGKPPRSF LGVGSSCGLY TGQRNGKPNI  660
LRPQSKFEKQ CQNVPDDDIP EILQENHSPS SGIKTSSPNS KRVSPPQNNF GSSPGPRSGR  720
KLILQSIPSF PSLTPQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1744356214121Protein lin-54 homolog
5fd3_B4e-1744356214121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1425432PKKKRRRL
2426431KKKRRR
3428432KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.117870.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G083400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175861e-138AC217586.1 Populus trichocarpa clone POP025-M11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315756.20.0protein tesmin/TSO1-like CXC 2
TrEMBLB9HUS40.0B9HUS4_POPTR; Uncharacterized protein
STRINGPOPTR_0010s09350.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-164TESMIN/TSO1-like CXC 2