PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G055000.1
Common NamePOPTR_0010s06510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 385aa    MW: 44078.2 Da    PI: 6.5218
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G055000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.95e-2775156286
            trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         W ++e++ Li +rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+ +++     s +++y+++++
  Potri.010G055000.1  75 WVQDETRSLIGLRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHKDRGS---GSAKMSYYKEID 156
                         ******************************************************************9984...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-467133IPR009057Homeodomain-like
PROSITE profilePS500908.45567131IPR017877Myb-like domain
SMARTSM007170.002271133IPR001005SANT/Myb domain
CDDcd122037.36E-2973138No hitNo description
PfamPF138371.7E-2174158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MYSSEKPRPL DFYKEEVTPS SRDNMIIEVV SSNGDLPPHH LPTTTNTNPH QMILGDSSGD  60
DNHEVKAPKK RAETWVQDET RSLIGLRREM DGLFNTSKSN KHLWEQISAK MREKGFDRSP  120
TMCTDKWRNL LKEFKKAKHK DRGSGSAKMS YYKEIDEILR ERNKNPQYKS PIPSKVDSYM  180
QFADKGFEDT SISFGPVEAS PRPTLNLERR LDHDGHPLAI TAADAVAASG VPAWNWRETP  240
GNGAENQSYG GRVISVKYGD YTRRIGVDGT ADAIKEAIKS AFRLRSKRAF WLEDEDQIIR  300
SLDRDMPPGN YTLHLDEGLA IKVCLYDESE HMPVHTEEKI FYTEDDYREF LSRRGWTCLR  360
EFDGYRSIDS MDDLRHDAIY RGVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-5169154186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.9250.0bud| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315635.20.0DNA-binding protein GT-1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLB9HTC30.0B9HTC3_POPTR; DNA-binding protein GT-1
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59331318
FabidsOGEF68173248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein