PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G053100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 547aa    MW: 61455.8 Da    PI: 6.4657
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G053100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.49.1e-25200253155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++W+ eLH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Potri.010G053100.1 200 KARVVWSVELHQKFVKAVNQI-GFDKVGPKKILDLMNVPRLTRENVASHLQKYRL 253
                         68*******************.9*******************************8 PP

2Response_reg79.11.5e-26201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l++  y ev+++  +++al+ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++  ge + + + 
  Potri.010G053100.1  20 VLVVDDDPTWLKILEKMLKRCSY-EVTTCGLARDALNLLRERKggYDIVISDVYMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKG 108
                         89*********************.***************999999**********************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ ++el++
  Potri.010G053100.1 109 VQHGACDYLLKPIRMKELRN 128
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.7E-1431495IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23004.8E-4417141No hitNo description
SuperFamilySSF521722.42E-3517143IPR011006CheY-like superfamily
SMARTSM004485.5E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.91319134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2320129IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.62E-3021134No hitNo description
PROSITE profilePS512949.605197256IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-28197258IPR009057Homeodomain-like
SuperFamilySSF466894.03E-18198257IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-22200253IPR006447Myb domain, plants
PfamPF002495.3E-8202252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MMENGFSSPR NDSFPAGLRV LVVDDDPTWL KILEKMLKRC SYEVTTCGLA RDALNLLRER  60
KGGYDIVISD VYMPDMDGFK LLEHVGLEMD LPVIMMSVDG ETSRVMKGVQ HGACDYLLKP  120
IRMKELRNIW QHVFRKKIHE VRDIEILEGI ESFQMTRNGS DLYEDGHFLC GEDLTLIKKR  180
KDIESKHDEK DIGDNTSAKK ARVVWSVELH QKFVKAVNQI GFDKVGPKKI LDLMNVPRLT  240
RENVASHLQK YRLYLSRLQK GNDFNNPVGM IKQSDSPLSD SAGSFGSQNS INLQPTDVSN  300
GCYGFSVSSL VLHNVDPRSH NGDRKILVTT PVAEPKRGVT VDAPNPRKPR ISQMEFGHPL  360
APHFNDGFSH LPMPGQKQLT RADYPQPARA ISSAHSLTER EIGCPVKIKP SRNDYGSNAS  420
HVSSTANAVD SIPLQTKTNS TNHQVSSTSS MENQGLNMNC LTDVESSRKN INLGMPPFAP  480
LDEDLQVRFV PGDYYMNLGL QNIEVPEYFD PSLLTDVPIH LNDGLRFDYE FYDPTEYSLI  540
DQSLFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19196258163ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G053100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081430.0FN908143.1 Populus x canadensis mRNA for putative B-type response regulator 21 (rr21 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315642.30.0two-component response regulator ARR11 isoform X2
SwissprotQ5N6V81e-133ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A2K1YPA90.0A0A2K1YPA9_POPTR; Two-component response regulator
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-128response regulator 11
Publications ? help Back to Top
  1. Du L, et al.
    The two-component signal system in rice (Oryza sativa L.): a genome-wide study of cytokinin signal perception and transduction.
    Genomics, 2007. 89(6): p. 697-707
    [PMID:17408920]