PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G042400.1
Common NamePOPTR_0010s05220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 217aa    MW: 24252.3 Da    PI: 6.2273
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G042400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY209.99e-6561702169
               YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvek 88 
                         ++f+ ++q+CyvqC+fC+til+vsvP +s+++vvtv CGhC+sllsvnl+k s    +ll++ sh d + ++ell  +   e n ++    
  Potri.010G042400.1   6 HLFDPPDQICYVQCGFCTTILLVSVPCSSSSTVVTVICGHCSSLLSVNLTKISflpfNLLTSLSH-D-QERKELLSPD---EVNAQKGLD- 90 
                         7899**********************************************999555556666666.2.2222222222...222222222. PP

               YABBY  89 eesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                         ++s+   +ss + +e+ d+  p    +++PPekrqr+Psayn+fikeei+r+k++nP+++h+eafs+aaknWah P++h++
  Potri.010G042400.1  91 TQSSFIAISSDN-DEDIDKVNPVNRVINKPPEKRQRAPSAYNCFIKEEIRRLKTENPNMAHKEAFSTAAKNWAHCPHVHYK 170
                         222222222222.4555555555455789**************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.2E-6210170IPR006780YABBY protein
SuperFamilySSF470951.03E-8112165IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.108.0E-6118165IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MSTLNHLFDP PDQICYVQCG FCTTILLVSV PCSSSSTVVT VICGHCSSLL SVNLTKISFL  60
PFNLLTSLSH DQERKELLSP DEVNAQKGLD TQSSFIAISS DNDEDIDKVN PVNRVINKPP  120
EKRQRAPSAY NCFIKEEIRR LKTENPNMAH KEAFSTAAKN WAHCPHVHYK GDGESIGLEE  180
ENSTWSSDAA EVNIESKGFH ERKVPRHYMW AKTPFE*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First detected in a group of around 15 epidermal cells on the abaxial half of each ovule primordium (chalaza, outer integument initiation sites). Later present in the outer cell layer of the outer integument on the abaxial side of the ovule primordium. Confined to the chalazal end of the integument and disappears after anthesis. Also present in embryos at the globular stage. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}.
Functional Description ? help Back to Top
Source Description
UniProtEssential for the formation and the abaxial-adaxial asymmetric growth of the ovule outer integument. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:9093862, ECO:0000269|PubMed:9118807}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G042400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Autoinduction down-regulated by SUP in adaxial region of the ovule outer integument. Negatively and spatially regulated by HLL, ANT, BELL1, NZZ/SPL and SUP. {ECO:0000269|PubMed:10601041, ECO:0000269|PubMed:12183380, ECO:0000269|PubMed:12183381}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045290.11e-153PREDICTED: axial regulator YABBY 4
SwissprotQ9LDT32e-72YAB4_ARATH; Axial regulator YABBY 4
TrEMBLA0A2K1YNQ71e-161A0A2K1YNQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s05220.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61442852
Representative plantOGRP9612712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.11e-62YABBY family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Simon MK,Skinner DJ,Gallagher TL,Gasser CS
    Integument Development in Arabidopsis Depends on Interaction of YABBY Protein INNER NO OUTER with Coactivators and Corepressors.
    Genetics, 2017. 207(4): p. 1489-1500
    [PMID:28971961]