PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G039300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 231aa    MW: 25698.7 Da    PI: 9.3613
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G039300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.8e-1496140347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Potri.010G039300.1  96 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 140
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.614619IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.83689145IPR017930Myb domain
SuperFamilySSF466893.14E-1791145IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-1792143IPR006447Myb domain, plants
SMARTSM007171.8E-1093143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-1195140IPR009057Homeodomain-like
PfamPF002491.1E-1196140IPR001005SANT/Myb domain
CDDcd001676.66E-1096141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006338Biological Processchromatin remodeling
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0035066Biological Processpositive regulation of histone acetylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0004402Molecular Functionhistone acetyltransferase activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MMSRSCSQCG NNGHNSRTCG ESPCCGDQNV TPTGIMLFGV RLAEGAASFR KSASMINLSQ  60
YEQPHEEPNA DVAAGYESDD VVHASGRSRE RKRGVPWTEE EHKLFLLGLQ KVGKGDWRGI  120
SRNFVKTRTP TQVASHAQKY FLRRNNQNRR RRRSSLFDIT TDTFMISGGS SMEEDQVHQE  180
TPALALPQLQ PQPQPRLNNN RPEGLPMSTF PVISPVTSPR EADIRTDKRG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.105770.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
UniprotTISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G039300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473910.0EF147391.1 Populus trichocarpa clone WS01230_F05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011043023.11e-148PREDICTED: transcription factor MYB1R1-like
SwissprotQ9LVS04e-59KUA1_ARATH; Transcription factor KUA1
TrEMBLA0A2K1YNG81e-172A0A2K1YNG8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s04860.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-76MYB_related family protein
Publications ? help Back to Top
  1. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]