PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G020900.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 159aa    MW: 18139.6 Da    PI: 4.2558
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G020900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.51.1e-11749246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                         rW++++ el++++++q+G++  + I + ++ gRt+ q+k+++ k
  Potri.010G020900.2  7 SRWSKQDTELFYEGIQQFGTD-LSMIQQLFP-GRTRHQVKLKYKK 49
                        59*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-27381No hitNo description
PROSITE profilePS5129310.655452IPR017884SANT domain
SMARTSM007171.7E-7553IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-11756IPR009057Homeodomain-like
CDDcd001675.97E-7849No hitNo description
Gene3DG3DSA:1.10.10.603.0E-7849IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MDRAPNSRWS KQDTELFYEG IQQFGTDLSM IQQLFPGRTR HQVKLKYKKE ERQHPLRLHE  60
ALSSRPKDNS YFEKLIEQLQ EVAGTQEEQE SYKDDLVDVS GEEDAELNAE TSGEVTKPEQ  120
GENAGVEEEQ EKNVAEDHHG PLKSGVSDED VDDIWGSY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G020900.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142138e-76AC214213.1 Populus trichocarpa clone POP024-E15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024467166.11e-109transcription factor TFIIIB component B'' homolog isoform X2
RefseqXP_024467167.11e-109transcription factor TFIIIB component B'' homolog isoform X3
RefseqXP_024467168.11e-109transcription factor TFIIIB component B'' homolog isoform X4
RefseqXP_024467169.11e-110transcription factor TFIIIB component B'' homolog isoform X5
TrEMBLA0A3N7FL101e-109A0A3N7FL10_POPTR; Uncharacterized protein
TrEMBLA0A3N7FMI51e-108A0A3N7FMI5_POPTR; Uncharacterized protein
TrEMBLA0A3N7FQI31e-108A0A3N7FQI3_POPTR; Uncharacterized protein
STRINGPOPTR_0010s02120.11e-60(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-31MYB_related family protein