PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G020900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 567aa    MW: 63323.9 Da    PI: 4.5307
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G020900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.9e-11415457246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rW++++ el++++++q+G++  + I + ++ gRt+ q+k+++ k
  Potri.010G020900.1 415 SRWSKQDTELFYEGIQQFGTD-LSMIQQLFP-GRTRHQVKLKYKK 457
                         59*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159639.1E-28407489No hitNo description
PROSITE profilePS5129310.655412460IPR017884SANT domain
SMARTSM007171.7E-7413461IPR001005SANT/Myb domain
SuperFamilySSF466899.72E-11415464IPR009057Homeodomain-like
CDDcd001677.90E-7416457No hitNo description
Gene3DG3DSA:1.10.10.602.2E-6416457IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
ESGAFPGLET PGFLSPDVME SVMAPPPNVQ PVPSETINID GCSVAAFPSD NIVDSPCTHL  60
DNVTAIHQED ASDLPEKETS SSRKRKAAPV SCSSWKSQKA SLAGDMNEHD KSSRHLTKQA  120
AAPQLGDEPE YEAHGNDDSS MHPGDFLPFD PCTSEFQVDQ NQKDFTESNC LANANVVRSE  180
DVPVVPEKES SKSGKRKVFS ASNCSRKSKK SSLAAGPQVV DELDEAHDNG GLPEPPGSSV  240
DEEDNDYEPR GDEESDDENK VEIASRKKRA SKKSKEPVTE NEKPVRKRNR SNDTSEQSMQ  300
KPRKKFSHST RRNKRCVNKD LLNMPEDEID FKRLPIRDII LFAEYKERLA TTTSKIPPNN  360
QSTDNPFHGE YSHNEEDGFA SEQDITHGDD QTYVRAQPSS SLFNYQSFMD RAPNSRWSKQ  420
DTELFYEGIQ QFGTDLSMIQ QLFPGRTRHQ VKLKYKKEER QHPLRLHEAL SSRPKDNSYF  480
EKLIEQLQEV AGTQEEQESY KDDLVDVSGE EDAELNAETS GEVTKPEQGE NAGVEEEQEK  540
NVAEDHHGPL KSGVSDEDVD DIWGSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195209RKVFSASNCSRKSKK
2267275KRASKKSKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G020900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142130.0AC214213.1 Populus trichocarpa clone POP024-E15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024467168.10.0transcription factor TFIIIB component B'' homolog isoform X4
TrEMBLA0A3N7H7E40.0A0A3N7H7E4_POPTR; Uncharacterized protein
STRINGXP_002512944.11e-123(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Representative plantOGRP8075913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.13e-46MYB_related family protein