PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G019600.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 549aa    MW: 61444.8 Da    PI: 4.5209
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G019600.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.5e-11397439246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rW++++ el++++++q+G++  + I + ++ gRt+ q+k+++ k
  Potri.010G019600.5 397 SRWSKQDTELFYEGIQQFGTD-LSMIQQLFP-GRTRHQVKLKYKK 439
                         59*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159638.7E-28389471No hitNo description
PROSITE profilePS5129310.655394442IPR017884SANT domain
SMARTSM007171.7E-7395443IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11397446IPR009057Homeodomain-like
CDDcd001677.53E-7398439No hitNo description
Gene3DG3DSA:1.10.10.602.1E-6398439IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MESVMAPPPN VQPVPSETIN IDGFSVAAFP SDNIVDSPCT HLDNVTAIHQ EDASDLPEKE  60
TSSSRKRKAA PVSCSSWKSQ KASLAGDMNE HDKSSRRLTK QAAAPQLGDE PEYEAHGNDD  120
SSMHPGDFLP FDPCTSEFQV DQNQKDFTES NCLANANVVR SEDVPVVPEK ESSKSGKRKV  180
FSASNCSRKS KKSSLAAGPQ VVDELDEAHD NGGLPEAPGS SVDEEDNDYE PRGDEESDDE  240
NKVEIASRKK RASKKSKEPV TENEKPVRKR NRSNDTAEQS MQKPGKKFSH STRRNKRCVN  300
KDLLNMPEDE IDFKRLPIRD IILFAEYKER LATTTSKIPP NNQSTDNPFH GEYSHNEEDG  360
FASEQDITHG DDQTYVRAQP SSSLFNYQSF MDRAPNSRWS KQDTELFYEG IQQFGTDLSM  420
IQQLFPGRTR HQVKLKYKKE ERQHPLRLHE ALSSRPKDNS YFEKLIEQLQ EVAGTQEEQE  480
SYKDDLVDVS GEEDAELNAE TSGEVTKPEQ GENAGVEEEQ EENVAEDHHG PLKSGVSDED  540
VDDIWGSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177191RKVFSASNCSRKSKK
2249257KRASKKSKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G019600.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142130.0AC214213.1 Populus trichocarpa clone POP024-E15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024467168.10.0transcription factor TFIIIB component B'' homolog isoform X4
TrEMBLA0A2K1YMI20.0A0A2K1YMI2_POPTR; Uncharacterized protein
STRINGXP_002512944.11e-121(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-46MYB_related family protein