PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G019600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 667aa    MW: 73886.5 Da    PI: 4.4514
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G019600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.59.6e-11515557246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rW++++ el++++++q+G++  + I + ++ gRt+ q+k+++ k
  Potri.010G019600.2 515 SRWSKQDTELFYEGIQQFGTD-LSMIQQLFP-GRTRHQVKLKYKK 557
                         59*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.2E-27507589No hitNo description
PROSITE profilePS5129310.655512560IPR017884SANT domain
SMARTSM007171.7E-7513561IPR001005SANT/Myb domain
SuperFamilySSF466891.2E-10515564IPR009057Homeodomain-like
CDDcd001679.94E-7516557No hitNo description
Gene3DG3DSA:1.10.10.602.7E-6516557IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MLPVESSGVE NGRLTDHVSE PNMESAGTKE PGRNNGQALL SPPEILATVF CQKDSKGKSS  60
FPAQNFVDSS AFMKCNVVAT DFSSPNEAAV QVDNGRLELE ESGAFPGLET PGFLSPDVME  120
SVMAPPPNVQ PVPSETINID GFSVAAFPSD NIVDSPCTHL DNVTAIHQED ASDLPEKETS  180
SSRKRKAAPV SCSSWKSQKA SLAGDMNEHD KSSRRLTKQA AAPQLGDEPE YEAHGNDDSS  240
MHPGDFLPFD PCTSEFQVDQ NQKDFTESNC LANANVVRSE DVPVVPEKES SKSGKRKVFS  300
ASNCSRKSKK SSLAAGPQVV DELDEAHDNG GLPEAPGSSV DEEDNDYEPR GDEESDDENK  360
VEIASRKKRA SKKSKEPVTE NEKPVRKRNR SNDTAEQSMQ KPGKKFSHST RRNKRCVNKD  420
LLNMPEDEID FKRLPIRDII LFAEYKERLA TTTSKIPPNN QSTDNPFHGE YSHNEEDGFA  480
SEQDITHGDD QTYVRAQPSS SLFNYQSFMD RAPNSRWSKQ DTELFYEGIQ QFGTDLSMIQ  540
QLFPGRTRHQ VKLKYKKEER QHPLRLHEAL SSRPKDNSYF EKLIEQLQEV AGTQEEQESY  600
KDDLVDVSGE EDAELNAETS GEVTKPEQGE NAGVEEEQEE NVAEDHHGPL KSGVSDEDVD  660
DIWGSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295309RKVFSASNCSRKSKK
2367375KRASKKSKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G019600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142130.0AC214213.1 Populus trichocarpa clone POP024-E15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024466756.10.0uncharacterized protein LOC7475967 isoform X6
TrEMBLA0A2K1YMI20.0A0A2K1YMI2_POPTR; Uncharacterized protein
STRINGXP_002512944.11e-120(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-45MYB_related family protein