PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G019600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 1097aa    MW: 119557 Da    PI: 4.5365
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G019600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.71.7e-10945987246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rW++++ el++++++q+G++  + I + ++ gRt+ q+k+++ k
  Potri.010G019600.1 945 SRWSKQDTELFYEGIQQFGTD-LSMIQQLFP-GRTRHQVKLKYKK 987
                         59*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159632.3E-279371019No hitNo description
PROSITE profilePS5129310.655942990IPR017884SANT domain
SMARTSM007171.7E-7943991IPR001005SANT/Myb domain
SuperFamilySSF466892.24E-10945993IPR009057Homeodomain-like
CDDcd001671.86E-6946987No hitNo description
Gene3DG3DSA:1.10.10.604.9E-6946987IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1097 aa     Download sequence    Send to blast
MDPDLDPFDD ILPKPALTNA RLGGKFQPKA KPRPKKVEFV PIPFPPSKAK EKAVAASQTS  60
LDTNISVQPF GIMDEKLTCQ IGSLSPSSPT GTKEPLKSND GKTKLVEESG SPLATSDMVG  120
VKEPLKYKEG LSSWEIGSLE AANLSPARIN DAGSVGAMDS EAAISGCNDD QESSFVKSAG  180
VAGSLGFDSD LLDDILPKSL KNNSRAGGKF KPKAKPRQRN ENPAPVSSSP SKCAKEEPKA  240
HSQQTQSTEP VDVANTRMNP DGPTLLQQGN VKSNEPSKDS EILYFNDNSC MELVNPSSEN  300
IATEEDVSPQ NTLLAEMKSG NDVGLNSRLV ESAIEVGSMR LDLDAFDYMD PQPAISTGRA  360
AGKLQSKVKA RPRKGTSELA ASAVPNTAVE KVAGLASTVL DNMLPVESSG VENGRLTDHV  420
SEPNMESAGT KEPGRNNGQA LLSPPEILAT VFCQKDSKGK SSFPAQNFVD SSAFMKCNVV  480
ATDFSSPNEA AVQVDNGRLE LEESGAFPGL ETPGFLSPDV MESVMAPPPN VQPVPSETIN  540
IDGFSVAAFP SDNIVDSPCT HLGDFIPSDP CTSEIRMNQE LKNLTETSRS DNVTAIHQED  600
ASDLPEKETS SSRKRKAAPV SCSSWKSQKA SLAGDMNEHD KSSRRLTKQA AAPQLGDEPE  660
YEAHGNDDSS MHPGDFLPFD PCTSEFQVDQ NQKDFTESNC LANANVVRSE DVPVVPEKES  720
SKSGKRKVFS ASNCSRKSKK SSLAAGPQVV DELDEAHDNG GLPEAPGSSV DEEDNDYEPR  780
GDEESDDENK VEIASRKKRA SKKSKEPVTE NEKPVRKRNR SNDTAEQSMQ KPGKKFSHST  840
RRNKRCVNKD LLNMPEDEID FKRLPIRDII LFAEYKERLA TTTSKIPPNN QSTDNPFHGE  900
YSHNEEDGFA SEQDITHGDD QTYVRAQPSS SLFNYQSFMD RAPNSRWSKQ DTELFYEGIQ  960
QFGTDLSMIQ QLFPGRTRHQ VKLKYKKEER QHPLRLHEAL SSRPKDNSYF EKLIEQLQEV  1020
AGTQEEQESY KDDLVDVSGE EDAELNAETS GEVTKPEQGE NAGVEEEQEE NVAEDHHGPL  1080
KSGVSDEDVD DIWGSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1725739RKVFSASNCSRKSKK
2797805KRASKKSKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G019600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142130.0AC214213.1 Populus trichocarpa clone POP024-E15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024466753.10.0uncharacterized protein LOC7475967 isoform X3
TrEMBLA0A2K1YMI70.0A0A2K1YMI7_POPTR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Representative plantOGRP8075913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.14e-45MYB_related family protein