PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G166900.2
Common NamePOPTR_0009s16830g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 809aa    MW: 90052.1 Da    PI: 8.623
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G166900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28477527252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l++yF++++kdAAk++gvc+T+LKriCR++GI RWP+Rkik++
  Potri.009G166900.2 477 EKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRKHGITRWPSRKIKKV 527
                         799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.382466547IPR003035RWP-RK domain
PfamPF020421.6E-24479527IPR003035RWP-RK domain
SuperFamilySSF542775.23E-23691785No hitNo description
Gene3DG3DSA:3.10.20.2402.6E-23698778No hitNo description
PROSITE profilePS5174522.936699782IPR000270PB1 domain
SMARTSM006661.8E-24699782IPR000270PB1 domain
CDDcd064072.02E-43700781No hitNo description
PfamPF005647.1E-17700781IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MHAIGQLKQC TKDRDLLIQI WVPIKKEGKH VLTTFGQPYL LNPKSQSLAS YRNVSKKFQF  60
PAEEDSKELV GLPGRVFLRK LPEWTPDVSY FSWVEYPRKN HAKQFNIRGS FAVPVFEQGS  120
RTCLGVIEVV TTTQDVSYRS ELESVCKALE AVDLRSPKDF RPSSLKACKE FCQAAVPEIS  180
KILESVCKTH RLPLALTWAP CFRQGKGGCR HFDENYSNCI CTVNSACFVA ETDNFGFYVA  240
CSEQYLSFGQ GIVGRAFTTR KQCFSTDVAA FSKTDYPLSH HAKMFELHAA IAIPVQSTYA  300
GPVDFVLEFF FPKDCCNTEE QKRMWDILPI TIKQACWSLH VVMDKELEET VNKKMVVASD  360
ERLNKDETQK FASLFKESSE AESSWIARVA EAQQKGKGVC VSWDHRKEEN KEEFKVTSHW  420
GKTQDELYHK QAFPEFGKFQ QNSVPKGSIE STTDAASAEH HSVGSRKSGD KRRTKTEKTI  480
SLQVLRQYFA GSLKDAAKSI GVCPTTLKRI CRKHGITRWP SRKIKKVGHS LKKLQLVIDS  540
VQGAEGAIQI GSFYTTFPEL TSPNFSANGG FPSSKANDDS NKSNHRPENG IFSAAASASK  600
SPSSSSSQSS GSSICCSTGV KQHTTTNNGS VSGYPLLVED PGGVLKRTHS DAALHALNRD  660
KSEPLIRSQS FKTFGDLPNP ETLPPLPKSS SQIIRDRSGF RVKATFGADK IRFTLQPNWG  720
FRDLQQEIAR RFNIDDICRI DLKYLDDDQE WVLLTCDADL EECKDVYKLS ESHTIKMSLN  780
QPSQPHLGSS LGSVGPNLVS LLGGGGPF*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G166900.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463757.10.0protein NLP1
RefseqXP_024463758.10.0protein NLP1
RefseqXP_024463759.10.0protein NLP1
RefseqXP_024463760.10.0protein NLP1
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLU5GKC20.0U5GKC2_POPTR; Uncharacterized protein
STRINGPOPTR_0009s16830.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein