PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G166800.1
Common NamePOPTR_0009s16820g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 794aa    MW: 88475.3 Da    PI: 7.7404
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G166800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.3e-27473523252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++isle+l++yF++++kdA+++Lgvc T+LKriCRq+GIkRWP+Rki+++
  Potri.009G166800.1 473 IQTISLEVLRRYFAGSLKDASQSLGVCSTTLKRICRQHGIKRWPSRKINKV 523
                         579**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.587459543IPR003035RWP-RK domain
PfamPF020424.4E-24475523IPR003035RWP-RK domain
SuperFamilySSF542771.08E-16692780No hitNo description
PROSITE profilePS5174514.96697771IPR000270PB1 domain
SMARTSM006662.8E-15697780IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.9E-16698776No hitNo description
PfamPF005641.1E-11700779IPR000270PB1 domain
CDDcd064073.65E-30700779No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MLTETSTPFA HPASCRVEAA GLGFEWQMVQ RVNPGTSFSV KERVMQAVGY LKHCIQDRDI  60
LIQIWLPMEK EGKRDAKRSV GFPGRVFLEK LPEWTPDVRL FRSEEYPHRD HAVQHNIRGS  120
LALPLFTQGS ETCLGIVEIA TTIQKISYRP ELQDICKVLQ AVDLRSSEDF CSPGVETCNR  180
LNRAAVPEIS DIVKSVCKTY RLPLALTWAL CSRQGKSGRQ QFPERFSSCI STVDSACFLA  240
DRGFSGFHMA SFEQYLFLGQ GIVGRAFTTQ KQCFTNDITS FSKKDYPLAH HAKIFGLHAA  300
IAIPLRSIST GLVEFVLEFF LPKDCQDTEE QKEMWDLLPI SIKQVCWSLQ VVMDKELDQG  360
ENQSFVSSPS KEPPRDESSW IAWMVEAQKK GKSCCITWDY PKEPKEEFKM ITPWDDSEEE  420
LDNKQVISEL GQLQQNPRPN SCIEGDGVSS AFGGCRSLGS RKTGKKRRTK TAIQTISLEV  480
LRRYFAGSLK DASQSLGVCS TTLKRICRQH GIKRWPSRKI NKVGHSLRKL QQVIDTVQGA  540
KGAVQIESFY SAFPELSSPK ISSHAPYSSL RSDNSKHLDS PPDDSSPSGT ASKSHSSPCS  600
GKSCSSNCCS ARAQQHDATT ITVSSNGNGA LLAETSNGIL KRTCSSELAE FHSMNNHGDP  660
DFLVRSQIHK TRTVSGHIHQ SELGSPRFAQ SLREGGVFGV KAIFGVEKVR LGLQPNWGLR  720
DLQQEIGKRF EIDDFTDIGL NYMDDNGEWV RLTCDGDLEE CKEIHIFSQR NTMKISCHDP  780
NLVSMTSNTG ATL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1464469KKRRTK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G166800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024464572.10.0protein NLP2
TrEMBLB9HPY40.0B9HPY4_POPTR; Uncharacterized protein
STRINGPOPTR_0009s16820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein