PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G166400.1
Common NamePOPTR_0009s16790g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 905aa    MW: 101136 Da    PI: 7.4723
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G166400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK86.91.8e-27586635352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++isl +l++yF+++++dAA+++gvc+T+LKriCRq+GIkRWP+Rkik++
  Potri.009G166400.1 586 QTISLGVLRQYFAGSLNDAAQSIGVCPTTLKRICRQHGIKRWPSRKIKKV 635
                         789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.689571655IPR003035RWP-RK domain
PfamPF020429.9E-24588635IPR003035RWP-RK domain
SuperFamilySSF542771.31E-19806897No hitNo description
PROSITE profilePS5174520.071811894IPR000270PB1 domain
SMARTSM006661.1E-17811894IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.9E-20812891No hitNo description
CDDcd064072.32E-35814892No hitNo description
PfamPF005649.5E-14814893IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 905 aa     Download sequence    Send to blast
MDDHGSSTPN STFDIFSGNV TNWDFMDEIL YQGWFEKDGG FNFLQQGLST SNVLHDPSLY  60
FPVTGTTNWN SVETSTPFSH PASCRVEAAG LGFEWQMVQR VNPGTSCSVK ERVMQAVGYL  120
KNCIQDRDIL IQIWLPMEKE GKRVLATIDQ PYFVDPSCKS LASYRKVSTA YHFQAEEDAK  180
CSVGFPGRVF LEKLPEWTPD VRLFRSEEYP HRDHAVQHNI RGSLALPLFK QGSETCLGIV  240
EIATTIQKIS YRSELQDICK VLQAVDLRSS EDFCSPGVEI TIVFLLSQTC NRLNRAAVPE  300
ISDIVKSVCK TYSLPLALTW ALCSRQGKIG RQQFPERFSS CISTVDSACF LADRGFSGFH  360
MASFEQYLFL GQGIVGRAFT TQKQCFTNDI TSFSKKDYPL AHHAKIFGLH AAIAIPLRSI  420
STGLVEFVVE LFLPKDCQET EEQKKMWDLL PIVLKQVCRS LQIVMDKELH IGENKSFESS  480
PSKEAPPDES SWIASMLEAQ KKGKSCIVTW DYPKEPEEEF KTIIHWDDSA VEIDQKQVIS  540
ELGRLQQHSR PNINIEGDGV SFAFGGRRSL GSTKAGKKRR TKTEIQTISL GVLRQYFAGS  600
LNDAAQSIGV CPTTLKRICR QHGIKRWPSR KIKKVDHSLR KLQQVIDTVQ GAKGAVQIES  660
FYPAFPELSS PKLSNHTSYS SFRRIDNSKH LDSPPDDSCP SGTASKSHSS PCSRSSCSSN  720
CCSGRAQQHA ATTITGSSNG NGSLLAETSN GIFKRTCSNE LAELHSLNNQ GGPDFLVRSQ  780
IHKTRTVSDH IHQNELESPP RFGPSLREGG VFGVKAIYGV EKVRLGLQPK WGLRDLQQEI  840
GKRFEIDDFT CIGLKYMDDD GEWVLLTCDS DLEECKEIHR FSQTNTIKIS LHKYSSPFGF  900
RGSF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1576581KKRRTK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G166400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024464228.10.0protein NLP2 isoform X2
TrEMBLB9HPY40.0B9HPY4_POPTR; Uncharacterized protein
STRINGPOPTR_0009s16790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein