PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G123400.3
Common NamePOPTR_0009s12620g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 330aa    MW: 36593.7 Da    PI: 7.0447
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G123400.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18248281134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Potri.009G123400.3 248 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 281
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-8318327IPR016679Transcription factor, GATA, plant
SuperFamilySSF577163.33E-14241304No hitNo description
SMARTSM004014.4E-14242296IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.385242278IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-14246279IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.43E-13247304No hitNo description
PROSITE patternPS003440248273IPR000679Zinc finger, GATA-type
PfamPF003204.1E-16248281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEFRVEERAL KSSLLRELDT KTTSEQAFCE DFLALNTPGV VSFDQDFSVD CFLDFSNGEF  60
NDGYVQEQEE EKDSISVSSQ DRVDDDFNSN SSSFSDSFLA SELAVPTDDI AELEWVSHFV  120
DDSVSDVSLL VPACKGSSKR HAKNRFEPET KPTFAKTSCL FPSRVPSKAR TKRSRPTGRT  180
WSAGSNQSET PSSSTSSTSS MPCLVATNTV QTADSLSWLS EQPMKISKKR PAVHTSGLMA  240
STQFQRRCSH CQVQKTPQWR TGPLGAKTLC NACGVRYKSG RLFPEYRPAC SPTFSSEVHS  300
NSHRKVLEMR RKKEVAGAEP RLNQMVPSF*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G123400.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313763.20.0GATA transcription factor 5
SwissprotQ9FH572e-62GATA5_ARATH; GATA transcription factor 5
TrEMBLB9HRG70.0B9HRG7_POPTR; GATA transcription factor
STRINGPOPTR_0009s12620.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-55GATA transcription factor 5