PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G114900.2
Common NamePOPTR_0009s11780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 835aa    MW: 90344.2 Da    PI: 4.4646
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G114900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.71.9e-11173214245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         g+WT +E +ll++a +++  + W+ Ia+++  ++t  qc++++ 
  Potri.009G114900.2 173 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFV 214
                         89*****************88.*********.**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5093410.816152IPR007526SWIRM domain
SuperFamilySSF466896.36E-6244IPR009057Homeodomain-like
PROSITE profilePS501359.586112158IPR000433Zinc finger, ZZ-type
SMARTSM002911.8E-11112156IPR000433Zinc finger, ZZ-type
SuperFamilySSF578501.41E-11114173No hitNo description
PfamPF005692.2E-9115152IPR000433Zinc finger, ZZ-type
CDDcd023367.73E-23116160No hitNo description
PROSITE patternPS013570118144IPR000433Zinc finger, ZZ-type
PROSITE profilePS5129322.123170221IPR017884SANT domain
SMARTSM007172.7E-12171219IPR001005SANT/Myb domain
SuperFamilySSF466892.02E-12171223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-8172213IPR009057Homeodomain-like
PfamPF002492.7E-11173215IPR001005SANT/Myb domain
CDDcd001670.00163191216No hitNo description
PfamPF164957.9E-27680757IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MKKFNSNPNT LIEVKDLSEL EVSDLDARQE VLEFLDYWGL INFHPLQFDS APNADGDEAA  60
KKDSSLEKLF CFEAIQPCPS IVPKPNLAAP TTSSRLFPES AIAEELAKLE GPSVEYHCNS  120
CSADCSRKRY HCQKQADYDL CADCFNNGKF GSNMSSSDFI LMEPAEAAGA SGGKWTDQET  180
LLLLEALELY KENWNEIAEH VATKTKAQCI LHFVQMPIED AFFDVTNDMN GTSKVTVDAD  240
ATVDETSGPK DVLDTSESKT GASEDQPLTP PMEASKPEDT SEVKGSQEST ENEKSSEVIN  300
GPEISKSEDA SGVKVSEEMG ENVALRALTE AFEAVGYSPT PENRLSFSEV GNPVMALASF  360
LARLVGPNVA TASARSSLKS LSSNYPGMQL AARHCFLLED PPEERKKPSG SDCVATEMAD  420
HDAQKDKQEE KNQKENSPTS GLGDRDLSDD HRDKKVGDSV PEEKKPLDTS KGDSPEKVNA  480
VNEAETAVSH EEVEPCRSKE SSNSELPKDH TPSIVKESDG IPPKSACPPS SFKETLEVSS  540
AEEHSQLTEV AKDVDMVSDL KSSEKNEPSQ SVASMSVDEH SQAGDASKDV DMVSDSLPAD  600
KDGSQQPAKS NAGDHSQPTE STADVDMLSS QPSEVKPQGL KVESGATSEE GPKDSKKEKL  660
DSEVIKDDNK IDKIKRAAVS ALSAAAVKAK LLANQEEDQI RQLAASLIEK QLHKLEMKLA  720
FFNEMDSVIM RVREQLDRSR QRLYQERAQI IASRLGLPPS SRAVPPSLPA NRIAMNFANA  780
FPRPPMSMTA QRPPISRPMG ALAPTPDTLV STTTTAGNSI RPSGQEKLSS VGTK*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:14682613}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G114900.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4578182e-61AM457818.1 Vitis vinifera contig VV78X000502.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313800.10.0SWI/SNF complex subunit SWI3D
SwissprotQ8VY050.0SWI3D_ARATH; SWI/SNF complex subunit SWI3D
TrEMBLB9HRP30.0B9HRP3_POPTR; Uncharacterized protein
STRINGPOPTR_0009s11780.10.0(Populus trichocarpa)
Publications ? help Back to Top
  1. Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A
    AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time.
    Nucleic Acids Res., 2002. 30(15): p. 3412-21
    [PMID:12140326]
  2. Zhou C,Miki B,Wu K
    CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis.
    Plant Mol. Biol., 2003. 52(6): p. 1125-34
    [PMID:14682613]
  3. Sarnowski TJ, et al.
    SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development.
    Plant Cell, 2005. 17(9): p. 2454-72
    [PMID:16055636]
  4. Liu ZW, et al.
    The SET domain proteins SUVH2 and SUVH9 are required for Pol V occupancy at RNA-directed DNA methylation loci.
    PLoS Genet., 2014. 10(1): p. e1003948
    [PMID:24465213]
  5. Liu ZW, et al.
    Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.
    PLoS Genet., 2016. 12(5): p. e1006026
    [PMID:27171427]