PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G106600.3
Common NamePOPTR_0009s10980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 326aa    MW: 36362.2 Da    PI: 8.2155
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G106600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.85.8e-29261311151
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                         k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQ
  Potri.009G106600.3 261 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQ 311
                         79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.329258318IPR017930Myb domain
SuperFamilySSF466892.69E-14258314IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-24259311IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-24261315IPR006447Myb domain, plants
PfamPF002491.9E-6263311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGSLSSELSL DFARPSTAKA LPFLPKTIAD FLKEVSVIGD SAVKVLKVDG FIKDLEEEKR  60
KIDAFKRELP LCMLLLNDAI QVLREEPMQR GASKNQQPVL EEFIPLKKNI DDHHENDGLI  120
EEKDSKDKKN WMSSVQLWNA DDHHPSTDYL FDPKQNLKLE SKTNKKGNQY GNEDAFQAGI  180
GRTAARTFMP FKACSGLSSK EEKLPVPSLS LSTPGIKSLK EESNSTGSRS SCSRSVSTIS  240
GPNSDSNLRN GPQSQQQTAR KQRRCWSPEL HRRFVNALQQ LGGSQAATPK QIRELMQVDG  300
LTNDEVKSHL QVSFQFCLLP MVYDL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.94520.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G106600.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1472190.0EF147219.1 Populus trichocarpa clone WS01229_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463735.10.0myb family transcription factor EFM isoform X2
TrEMBLB9HRW40.0B9HRW4_POPTR; Uncharacterized protein
STRINGPOPTR_0009s10980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-50G2-like family protein