PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G106600.2
Common NamePOPTR_0009s10980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 407aa    MW: 44685.9 Da    PI: 8.0088
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G106600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.3e-33261316156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Potri.009G106600.2 261 KQRRCWSPELHRRFVNALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 316
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115258318IPR017930Myb domain
SuperFamilySSF466892.82E-18258319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-29259319IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-27261316IPR006447Myb domain, plants
PfamPF002496.4E-8263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGSLSSELSL DFARPSTAKA LPFLPKTIAD FLKEVSVIGD SAVKVLKVDG FIKDLEEEKR  60
KIDAFKRELP LCMLLLNDAI QVLREEPMQR GASKNQQPVL EEFIPLKKNI DDHHENDGLI  120
EEKDSKDKKN WMSSVQLWNA DDHHPSTDYL FDPKQNLKLE SKTNKKGNQY GNEDAFQAGI  180
GRTAARTFMP FKACSGLSSK EEKLPVPSLS LSTPGIKSLK EESNSTGSRS SCSRSVSTIS  240
GPNSDSNLRN GPQSQQQTAR KQRRCWSPEL HRRFVNALQQ LGGSQAATPK QIRELMQVDG  300
LTNDEVKSHL QKYRLHTRRV TPATAAAPAN QSVVVLGGLW MTQDQYGDSS KATSSQSGSP  360
QGPLQLAVNT GGTSTTGGDS MEDDEDAKSE GYSWKSHSHR SGKDDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-14261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-14261314255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.94520.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G106600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1472190.0EF147219.1 Populus trichocarpa clone WS01229_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313089.10.0myb family transcription factor EFM isoform X1
TrEMBLB9HRW40.0B9HRW4_POPTR; Uncharacterized protein
STRINGPOPTR_0009s10980.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-58G2-like family protein