PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G088400.1
Common NamePOPTR_0009s09150g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GeBP
Protein Properties Length: 382aa    MW: 42786.7 Da    PI: 5.6642
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G088400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573119.71.5e-37161256298
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         lfqrlw+eeDei+lLqG+idf a++g +ps+d++afy+f+k+s++f+vs +ql +Ki rL+kKf+++vk  k+g+++ fsk+hdqk f+ls
  Potri.009G088400.1 161 LFQRLWTEEDEIALLQGIIDFIAEKGYDPSKDMNAFYDFIKRSLHFDVSMTQLKDKISRLRKKFENHVKG-KKGESKIFSKPHDQKGFDLS 250
                         79******************************************************************99.99****************** PP

              DUF573  93 kkiWgs 98 
                         k iWgs
  Potri.009G088400.1 251 KYIWGS 256
                         ****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.9E-33162255IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MAPKRAPPVE DPPSASSSEE EEETSSGEEE ASDDEQSHPS PPQPQTKTIR TQNSAPKKPE  60
PTTQQSESEL ESDSGSESES ESESEPDQSV KPITSKPMEE TPPKEAAAVK KSRSKPAVAA  120
TPEKSTAVKR GNGADRDSKD LKRAKSKESE PEKSEDSKKQ LFQRLWTEED EIALLQGIID  180
FIAEKGYDPS KDMNAFYDFI KRSLHFDVSM TQLKDKISRL RKKFENHVKG KKGESKIFSK  240
PHDQKGFDLS KYIWGSEGTI KANGKKNNNS NDNRKGNAKK LEALKAELGM DVGEEERMEV  300
EMERDSSVKK VLKFDGSVSG GKMDDYVVRN GLDFAHGMKK AEMEEKWRKL HMAELELFLK  360
RNELIREQAK LMLSAFKADK D*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.111580.0bud| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G088400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1451180.0EF145118.1 Populus trichocarpa clone WS01120_J07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313912.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLB9HMZ50.0B9HMZ5_POPTR; GeBP family protein
STRINGPOPTR_0009s09150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Representative plantOGRP4222523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.17e-37DNA-binding storekeeper protein-related transcriptional regulator