PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G087500.1
Common NamePOPTR_0009s09060g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 676aa    MW: 76766.3 Da    PI: 6.4257
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G087500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.66.1e-29359409252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isl++l+kyF++++kdAAk++gvc+T+LKr CRqyGI+RWP+Rkik++
  Potri.009G087500.1 359 EKTISLQVLRKYFAGSLKDAAKSIGVCPTTLKRMCRQYGISRWPSRKIKKV 409
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.086348429IPR003035RWP-RK domain
PfamPF020428.3E-24361409IPR003035RWP-RK domain
SuperFamilySSF542772.19E-21569662No hitNo description
Gene3DG3DSA:3.10.20.2409.5E-21575656No hitNo description
PROSITE profilePS5174518.934576659IPR000270PB1 domain
SMARTSM006663.6E-21576659IPR000270PB1 domain
CDDcd064071.57E-34577656No hitNo description
PfamPF005649.9E-14577656IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MRIPLGLSYG LRCGESMKRR DIAEEEKDDF SKILHGPKKP LNYFYRKSQI KYSYHGTFTE  60
KPEVDSAARN LVRGQRETIN IQYNDGCVDK ARAQLVLGIV ITRVDKTILV EAMVLRLDHI  120
GFLDRSNNNY SWKSLFLFFI FTVPWLYKIQ VLSKIGMDHG AIRTNSIFRT TSDTFMDLNF  180
TDELLVQRYW WESAGGVNFL DPEPSISNDL CDPSQYVPFM GSGHLSINSH HRTCQEETDI  240
SLENPPVVYP ETEEQVVETI TSPVHSEGSQ LESGEFVLEF CESWECPKQE PEEEETLQET  300
TDSDNNDLDQ YQEREFSDFG QLQQNPEHCT VESAGDSFVP WSHLLGSRKT GKKRQTKTEK  360
TISLQVLRKY FAGSLKDAAK SIGVCPTTLK RMCRQYGISR WPSRKIKKVN HSLKKLQHVV  420
DSVMGAQGLI EIDSFYTAFP ELSSSGYFGH NPFSSFQITE YPKESNPKPI NHLFSTKGPV  480
SKSQSSSRSQ NSGLFICHGK RQLTSTINGL STGHALAVED PVEVLKRTRS KSELPSLNKE  540
ELDRAKSNET SCQHQNLETQ ASLPINNGQC LRDGGAFRIK ATFGDENIRF SLQPNWGFRD  600
LQREIAKRFE IDDFSRIGLK YLDNDHESIL LTCDADLEEC KDLLGFSQSR TIKITLYLVS  660
KPNLGSSFSS SRDLF*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G087500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463895.10.0protein NLP2
RefseqXP_024463896.10.0protein NLP2
SwissprotQ7X9B91e-93NLP2_ARATH; Protein NLP2
TrEMBLA0A3N7FP050.0A0A3N7FP05_POPTR; Uncharacterized protein
STRINGPOPTR_0009s09060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2820433
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.12e-91Nin-like family protein