PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G071700.1
Common NamePOPTR_0009s07600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 523aa    MW: 58586.6 Da    PI: 7.4959
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G071700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.5e-192175357
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        kRt  t+ q+ +Le+++++++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  Potri.009G071700.1 21 KRTVKTPAQVVALENFYNEHKYPTEEMKSELADQIGLTEKQISSWFCHRRLKDKR 75
                        8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-22275IPR009057Homeodomain-like
PROSITE profilePS5007116.9411676IPR001356Homeobox domain
SuperFamilySSF466899.84E-181881IPR009057Homeodomain-like
SMARTSM003893.3E-191880IPR001356Homeobox domain
CDDcd000865.20E-182175No hitNo description
PfamPF000467.3E-172175IPR001356Homeobox domain
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MEESSEVHFG ENRVSPEKNL KRTVKTPAQV VALENFYNEH KYPTEEMKSE LADQIGLTEK  60
QISSWFCHRR LKDKRLRDEV CTNGRQDRSS GIIQDRGSGL RQDSCGSTKQ GDYRNLDPRE  120
VESQRLYGRD FHPADLTYDR TSRYTGNVTG IDNISSGSSS SLQDKFVCQR EDPYDAETSK  180
YLAQNGAAMP LIPKGTDSFG YKPSGYLKVK GEIENAAITA VKMQLGRHYK EDGPPLGVEF  240
QPLPPGAFAS PSRDPVSGPI YVGDLAQMCS PDVSGVRKQS SLGARYEVYS TKMSSHDSYT  300
EGANCNPEPS DSHDRKSHHH LEQKPTYNGS NSNAGGNSAM DMLDDLAGET SAYVNKRHYR  360
MSSKHGFEGT RSDSLSTHLG PSGRRVNSEK TEAWLHDCDN DNPKIVQRNN YTSKHPHLMR  420
GSGKSLDTEE RARCTIMEKE DKLHGEMKRM KGSHDPVRVK RHPTDETTVA KRFRVDFPQQ  480
EHVAKASFSE IRRRTNLTKR SAMERPSSFS EDETPETSSS AE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G071700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3956352e-39FQ395635.1 Vitis vinifera clone SS0AFA14YN23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024464501.10.0uncharacterized protein LOC7475016 isoform X1
TrEMBLA0A2K1Z4740.0A0A2K1Z474_POPTR; Uncharacterized protein
STRINGPOPTR_0009s07600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Representative plantOGRP8823814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-100HB-other family protein