PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G048700.1
Common NamePOPTR_0009s05330g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 471aa    MW: 52502.4 Da    PI: 6.2987
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G048700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.46.5e-142464671374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lLl+cA++v+sg+le+a+ +L+++s+laspdgd+mqR+aayf+eALa+r+++ ++++ kal++++ +   +se++ ++klf++++P++
  Potri.009G048700.1  46 LIHLLLTCANHVASGSLENAEIALSQISHLASPDGDTMQRIAAYFAEALARRIVKAWPGIDKALNATQIT--LVSEQILVRKLFYDMFPFM 134
                         689***************************************************************9998..7****************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         k++++++NqaI ea+ege++vH+iD+ + +++QW+aLlqa++ Rpegpp+lRiTg+++    +k  l +++++L + Ae+l++pf+fn+ +
  Potri.009G048700.1 135 KVAFVLTNQAIIEAMEGEKMVHVIDLHAAEPAQWIALLQAFSVRPEGPPHLRITGIHP----QKGVLDQMAHKLIEEAEKLDIPFQFNP-I 220
                         **********************************************************....9**************************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrll.........................................................de 216
                         +++le+l++e Lrvk+gEala++++lqlh++l                                                         ++
  Potri.009G048700.1 221 VSKLENLDIEILRVKTGEALAISSILQLHSFLasddelrkkspstlknsnginmqrvlqmnqntlgellekdtangyspspdsasssplSS 311
                         999********************************************************************************88665433 PP

                GRAS 217 svsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerre 307
                         ++s+  + d +L+ +++lsPk++vv+eq+++hn+++++er+leal++y+alfd+le++++r+s er kvE++l+g ei+n++acega+r+e
  Potri.009G048700.1 312 TASV--KMDCFLNSLWGLSPKLMVVTEQDSNHNGSTLMERLLEALYTYAALFDCLESTVSRTSMERLKVEKMLFGDEIKNIIACEGAARKE 400
                         3333..4699********************************************************************************* PP

                GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         rhe+lekW +rl+ aGF++v+ls++ + qa++ll+ ++ dgyr++ee+gs+v++W+drpL+svSaWr
  Potri.009G048700.1 401 RHEKLEKWIQRLDLAGFGNVSLSYYGMLQARRLLQGYGCDGYRMKEENGSVVICWQDRPLFSVSAWR 467
                         ******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.93820447IPR005202Transcription factor GRAS
PfamPF035142.1E-13946467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MYQDDGSSSV TSSPLQVFST MPVSPSMGSP YPWVRELKSE ERGLYLIHLL LTCANHVASG  60
SLENAEIALS QISHLASPDG DTMQRIAAYF AEALARRIVK AWPGIDKALN ATQITLVSEQ  120
ILVRKLFYDM FPFMKVAFVL TNQAIIEAME GEKMVHVIDL HAAEPAQWIA LLQAFSVRPE  180
GPPHLRITGI HPQKGVLDQM AHKLIEEAEK LDIPFQFNPI VSKLENLDIE ILRVKTGEAL  240
AISSILQLHS FLASDDELRK KSPSTLKNSN GINMQRVLQM NQNTLGELLE KDTANGYSPS  300
PDSASSSPLS STASVKMDCF LNSLWGLSPK LMVVTEQDSN HNGSTLMERL LEALYTYAAL  360
FDCLESTVSR TSMERLKVEK MLFGDEIKNI IACEGAARKE RHEKLEKWIQ RLDLAGFGNV  420
SLSYYGMLQA RRLLQGYGCD GYRMKEENGS VVICWQDRPL FSVSAWRCRK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-45464674375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089400.0AC208940.1 Populus trichocarpa clone JGIACSB1085-L05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314093.10.0scarecrow-like transcription factor 3 family protein
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLB9HP160.0B9HP16_POPTR; Scarecrow-like transcription factor 3 family protein
STRINGPOPTR_0009s05330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Representative plantOGRP25641433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3