PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G045900.1
Common NamePOPTR_0009s05050g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 202aa    MW: 22791.4 Da    PI: 6.5291
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G045900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.51e-141559145
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        kri n+  r vtfskRr gi KK +EL +L+++e+a ++fs+ gk
  Potri.009G045900.1 15 KRIVNEDDRLVTFSKRRSGIYKKLSELITLTGTEAAFLVFSPGGK 59
                        7999**************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.306767IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-21766IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-23879IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-14929IPR002100Transcription factor, MADS-box
PfamPF003192.3E-181663IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-142944IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-144465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEAKKTRGRQ KVEMKRIVNE DDRLVTFSKR RSGIYKKLSE LITLTGTEAA FLVFSPGGKP  60
FSFGHPSIEN VLDRFLENPS NADGTHELVE EYRRARIEEL TQKYDEMQQQ LDDDKEKGSK  120
LKDKIQGNER GDWWNAPVEE LNLQELIELE KKFEGLRMTL HSKMKDSSNG ASSSHAPEVG  180
NRSASHANDS NVASHGSNWG V*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G045900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313380.11e-148agamous-like MADS-box protein AGL29
TrEMBLB9HP411e-146B9HP41_POPTR; Uncharacterized protein
STRINGPOPTR_0009s05050.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04100.14e-36AGAMOUS-like 57