PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G033100.1
Common NamePOPTR_0009s03830g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 657aa    MW: 75110.5 Da    PI: 6.6774
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G033100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.17.1e-1142836524374
                GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                         +L+ cAea   gd++ a+a L+++++++sp gd++qRla+yf+++L++rla+++  l+   p +++s ++ ++ l+a++l++ ++P+ k++
  Potri.009G033100.1 283 QLILCAEAAGRGDQKTASAKLKQIRQHSSPFGDANQRLAHYFANGLEERLAGTGMLLS--GPITQNS-TTAADILKAYQLYVTICPFRKMT 370
                         7999************************************************444444..4444443.569******************** PP

                GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                         +l aN++I + +++++ vHiiDf+is+G+QWp+++   + Rp+gpp++RiTg++ p++g   +e++eetg+rL+++A++++vpfe+n+ +a
  Potri.009G033100.1 371 NLCANRTIARVADKATSVHIIDFGISYGFQWPCFMYRHSLRPGGPPKIRITGIDLPQPGfrPAERVEETGRRLKRLADRMNVPFEYNA-IA 460
                         **********************************************************9*****************************.7* PP

                GRAS 184 krledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +++e++++e+L++ +  +E+++Vn++++ ++l+d++++++s+rd+vLkl+k+++P+v+ +  ++ ++n++ F++rf eal +ysa fd+le
  Potri.009G033100.1 461 QKWETIQYEDLKIARdrDEVIVVNCMYRFKNLPDDTMASNSPRDAVLKLIKRINPDVFLHGVRNGSYNAPFFVKRFREALFHYSAYFDMLE 551
                         *************9999************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a++pre++er   Ere++gr++ nvvaceg++r+er et+++W++r  + GF+++pl +++ k +k++   +++d + v+e+ ++++lgWk
  Potri.009G033100.1 552 ANAPREDQERLLFEREMIGRDVINVVACEGTQRIERPETYKQWQMRNLRNGFRQIPLHQSIIKRMKSIKPDYHKD-FIVDEDGQWVLLGWK 641
                         *************************************************************************77.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         ++   ++SaW+
  Potri.009G033100.1 642 GKIFHAISAWK 652
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.564254633IPR005202Transcription factor GRAS
PfamPF035142.4E-111283652IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MVIESMEPPS FPNILQASTL GSSSDEDTAY SSDTNDFSHV VFKYINDMLM EDDLGDKTCM  60
LQDCLALQAA EKSLYDVLGE EHPPSSDHRP PCLAQINESA DENYTPTTSV QSSVLQSFYS  120
PESVFVVPYV HTETHSFRQF NGVTGSANKL LPYSHSVKFS SMRKASDPPE PEEEVVADRI  180
QNNGENYSSN QTRGRRNYQY DSNDYLEEGR SKKQPSVSES THWELLDDDF LHSIESGVHI  240
SCPLYDNSRS AAYNKFLHNE QLTASHMRMR TLANKRETDQ WTQLILCAEA AGRGDQKTAS  300
AKLKQIRQHS SPFGDANQRL AHYFANGLEE RLAGTGMLLS GPITQNSTTA ADILKAYQLY  360
VTICPFRKMT NLCANRTIAR VADKATSVHI IDFGISYGFQ WPCFMYRHSL RPGGPPKIRI  420
TGIDLPQPGF RPAERVEETG RRLKRLADRM NVPFEYNAIA QKWETIQYED LKIARDRDEV  480
IVVNCMYRFK NLPDDTMASN SPRDAVLKLI KRINPDVFLH GVRNGSYNAP FFVKRFREAL  540
FHYSAYFDML EANAPREDQE RLLFEREMIG RDVINVVACE GTQRIERPET YKQWQMRNLR  600
NGFRQIPLHQ SIIKRMKSIK PDYHKDFIVD EDGQWVLLGW KGKIFHAISA WKPVQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-462846528375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314169.10.0hypothetical protein POPTR_0009s03830g
TrEMBLB9HPF50.0B9HPF5_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-173GRAS family protein