PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G032700.2
Common NamePOPTR_0009s03790g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 763aa    MW: 85738.4 Da    PI: 4.9876
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G032700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS381.41.1e-1163907592373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++ L+ cA+avs +d + a++lL+++++++sp gd  qRla++f++AL+arla++++++y al++++ts    ++ l+a++++  ++P+ k
  Potri.009G032700.2 390 RTFLILCAQAVSVNDCRTANELLKQIRQHSSPLGDGSQRLAHCFANALEARLAGTGTQIYTALSAEKTS---AVDMLKAYQAYISACPFKK 477
                         67899**********************************************************999999...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++++ aN+ Il+ +e+++++HiiDf+i +G+QWp+L+  L++Rp+gpp+lRiTg++ p+sg   +e+++etg+rLak++e+ +vpfe+n+ 
  Potri.009G032700.2 478 IAFIFANHSILNVAEKASTLHIIDFGILYGFQWPSLIYRLSCRPGGPPKLRITGIELPQSGfrPTERVQETGRRLAKYCERYNVPFEYNA- 567
                         ************************************************************9*****************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a++++++++++L+++++E+laVn+ ++ ++llde+v ++s+r++vL+l+++++P+++v++  + ++n++ F++rf eal ++salfd+l+
  Potri.009G032700.2 568 IAQKWDTIQIDDLKIDRNEVLAVNCGFRFKNLLDETVVVNSPRNAVLNLIRKTKPDIFVHAIVNGSYNAPFFVTRFREALFHFSALFDMLD 658
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         +++pre++ r k E+e+ gre++nv+aceg+er+er et+++W+ r ++aG+k++p++    k+ k+ ++  + + + v+e+ +++++gWk
  Potri.009G032700.2 659 TNMPREDKMRLKFEKEFYGREVMNVIACEGSERVERPETYKQWQVRNMRAGLKQLPMDPLLIKKLKCKVKAGYHEDFVVDEDGNWMLQGWK 749
                         ***********************************************************************99899*************** PP

                GRAS 364 drpLvsvSaW 373
                         +r +++ SaW
  Potri.009G032700.2 750 GRIVYASSAW 759
                         ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.169363740IPR005202Transcription factor GRAS
PfamPF035143.9E-114390759IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 763 aa     Download sequence    Send to blast
MGSDSRYTEF PGSNKFEDEI VFPVSNQYQN VTNGFKIEDL DLDHLENPLV LPDPDPGNSA  60
LSSITSMDGD SPSDDNDSEN LLKYISQMLM EENMEEKPCM FHDPLALQAA ERSLYDILGE  120
KTLPSSPHES PSYGDQFLVD SPDDNFWSSR SDYSSNSSST SNTASLVDPQ WNGESGESKP  180
SFMQMPLSTN FVFQSAANPS SQSSFKLHNG LASNSDSAIK PSVGNIVVQN IFSDSDLALQ  240
FKRGVEEASK FLPKGNPLVI DLENSSLAPE MNRNAPNVVV KAEKEDKEDK EYLPEWLTGK  300
KNHEREDGDF EEERSNKQSA VYVDESELSE MFDMLLGFGD GCQPPQCILH EAEQRESGKT  360
LQQNGQTRGT NGSKTRAKRQ GNNKEVVDLR TFLILCAQAV SVNDCRTANE LLKQIRQHSS  420
PLGDGSQRLA HCFANALEAR LAGTGTQIYT ALSAEKTSAV DMLKAYQAYI SACPFKKIAF  480
IFANHSILNV AEKASTLHII DFGILYGFQW PSLIYRLSCR PGGPPKLRIT GIELPQSGFR  540
PTERVQETGR RLAKYCERYN VPFEYNAIAQ KWDTIQIDDL KIDRNEVLAV NCGFRFKNLL  600
DETVVVNSPR NAVLNLIRKT KPDIFVHAIV NGSYNAPFFV TRFREALFHF SALFDMLDTN  660
MPREDKMRLK FEKEFYGREV MNVIACEGSE RVERPETYKQ WQVRNMRAGL KQLPMDPLLI  720
KKLKCKVKAG YHEDFVVDED GNWMLQGWKG RIVYASSAWI PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-423937598374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.68710.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089320.0AC208932.1 Populus trichocarpa clone JGIACSB1081-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314172.20.0scarecrow transcription factor family protein
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9HPF80.0B9HPF8_POPTR; Scarecrow transcription factor family protein
STRINGPOPTR_0009s03790.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14