PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G029500.1
Common NamePOPTR_0009s03490g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 327aa    MW: 34651.5 Da    PI: 9.4374
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G029500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.5e-3869129262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nkk++
  Potri.009G029500.1  69 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKTK 129
                         67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3553125IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34873127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVFSSVPVYL DPPSWQQQQQ PSQQLGACDE SPQLPPLPPP PHVGGSGTAG SIRPGSMSDR  60
ARLAKIPQPE AALKCPRCDS TNTKFCYFNN YSLSQPRHFC KTCRRYWTRG GALRSVPVGG  120
GCRRNKKTKS QSSSKSPVSS ERQMGSTSST SSSALPSQII GHFPQQQTQF PFVTSLHNLT  180
QFGVGNIGLN FGGIQGQMGS TSGASGQAGM EFQMGSGSGM SSSSIFSAGG VQQFPFFESP  240
PAGLYPFQSD QGAEAPTGIP GESSQLRSMA SSSRVSQLAP VKSEGNQGLN LSKPYLGIPE  300
NNQYYWGGNT WTDLSGLNSS STSHFL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G029500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314189.10.0dof zinc finger protein DOF2.2 isoform X1
TrEMBLB9HPI60.0B9HPI6_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03490.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.18e-45Dof family protein