PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G029200.1
Common NamePOPTR_0009s03460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 247aa    MW: 27605.8 Da    PI: 7.2634
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G029200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-201877357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++tkeq+  Le+++ +  r+ps+e++e+++++l    +++ ++V++WFqN++a++++
  Potri.009G029200.1 18 SRWNPTKEQISMLESFYSQgIRTPSTEMIEQITSRLkaygHIEGKNVFYWFQNHKARQRQ 77
                        7*****************99**************************************97 PP

2Wus_type_Homeobox109.91.4e-351779365
   Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        ++RW+Pt+eQi +Le+ y++G+rtP++e i++it++L++yG+ie+kNVfyWFQN+kaR+rqkq
  Potri.009G029200.1 17 NSRWNPTKEQISMLESFYSQGIRTPSTEMIEQITSRLKAYGHIEGKNVFYWFQNHKARQRQKQ 79
                        68***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8351378IPR001356Homeobox domain
SMARTSM003893.2E-61582IPR001356Homeobox domain
SuperFamilySSF466892.52E-131686IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-91877IPR009057Homeodomain-like
PfamPF000465.7E-181877IPR001356Homeobox domain
CDDcd000861.97E-71979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDSDDMDVAG SGGAPGNSRW NPTKEQISML ESFYSQGIRT PSTEMIEQIT SRLKAYGHIE  60
GKNVFYWFQN HKARQRQKQK QESMAYINNY LHKVHQPVFA PPCANVVCSP YFPQQSEVMG  120
FCQQHPKMLL PSNFKMRPRS EARTYAFNGY EPAAPYGYHN RITMNKGERT LVTINHKSSS  180
DQATLPLFPL HPTGTLEGAT SICPVGSTDP AENSTNTPSS SEITTGIEEH SGDCKPFFDF  240
FYGKDS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G029200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827020.0KF982702.1 Populus tomentosa WOX2b (WOX2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002313442.20.0WUSCHEL-related homeobox 2
TrEMBLB9HPI90.0B9HPI9_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Representative plantOGRP85821116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-53WUSCHEL related homeobox 2