PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G027300.2
Common NamePOPTR_0009s03240g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 179aa    MW: 19781.8 Da    PI: 4.7589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G027300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-16242547
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        T++E+ l +++++++G++ W++Iar+++ gRt++++k++w+++
  Potri.009G027300.2  2 TPQEERLVLELHARWGNR-WSRIARKLP-GRTDNEIKNYWRTH 42
                        9*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.7E-11145IPR001005SANT/Myb domain
CDDcd001671.74E-12142No hitNo description
PROSITE profilePS5129423.49147IPR017930Myb domain
PfamPF002491.7E-14242IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-12247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-19244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MTPQEERLVL ELHARWGNRW SRIARKLPGR TDNEIKNYWR THTRKKAQER KSVVSPSLSS  60
SNCSSSSNIT TVNSSSPPGT GEASFYDTGG LEQVASAGKN GEAVQGGEKG YSMDDIWRDI  120
ENTIEPVCDG FSEEGCNFSY PSLASPSWEY RPDILWSISG EESKMFLPYD DGTMLLTG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.27790.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G027300.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024464921.11e-130transcription factor MYB48 isoform X1
SwissprotQ9LX826e-52MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A2K1Z1S71e-129A0A2K1Z1S7_POPTR; MYB family protein
STRINGPOPTR_0009s03240.11e-128(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.22e-51myb domain protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Imran QM, et al.
    Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes.
    Sci Rep, 2018. 8(1): p. 771
    [PMID:29335449]