PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G023600.1
Common NamePOPTR_0009s02850g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 384aa    MW: 42234.6 Da    PI: 6.4265
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G023600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.8e-18213267256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.009G023600.1 213 RKKLRLSKEQSSFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 267
                         788899***********************************************98 PP

2HD-ZIP_I/II127.17.4e-41213303192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlskeq+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Potri.009G023600.1 213 RKKLRLSKEQSSFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 302
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Potri.009G023600.1 303 K 303
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-18191270IPR009057Homeodomain-like
SuperFamilySSF466895.56E-18205270IPR009057Homeodomain-like
PROSITE profilePS5007117.329209269IPR001356Homeobox domain
SMARTSM003894.3E-16211273IPR001356Homeobox domain
PfamPF000463.9E-15213267IPR001356Homeobox domain
CDDcd000864.54E-16213270No hitNo description
PROSITE patternPS000270244267IPR017970Homeobox, conserved site
CDDcd146860.00955262301No hitNo description
SMARTSM003403.8E-25269312IPR003106Leucine zipper, homeobox-associated
PfamPF021836.0E-11269303IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MQNKREMELG LSLGDAATTS KPFGFMEKST QLTNKVTSGF CMGLSIGTNH TLQEEDEDKD  60
DHKLSNNIDH NSDNTNTRTA TVQANKGTIL TVDTSTDPPI QLDLLPNTPV PRNQNSILTL  120
ASDNGTNFEA GSSGNMSRGF DVNRFSAVMV HEDQADQDGA TLSSSPPNSA TSSFQMDFCI  180
YSSKGGSGSN IEADQAERAS SRASDEEENG SARKKLRLSK EQSSFLEESF KEHNTLTPKQ  240
KLALAKELNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCETLTEENR RLHKELQELR  300
ALKTSNPYYM QLPATTLTMC PSCERVAAAA TSATATTATT TTTNTQNNTT DPTSNTTGLS  360
LSSSRPRFYP FSHTQTHPHQ PKA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261269RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.155780.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G023600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314223.20.0homeobox-leucine zipper protein HOX11 isoform X1
SwissprotP466653e-95HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HPS00.0B9HPS0_POPTR; Uncharacterized protein
STRINGPOPTR_0009s02850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-78homeobox from Arabidopsis thaliana