PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.009G000100.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 143aa    MW: 15985.2 Da    PI: 9.6792
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.009G000100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY140.22.3e-432314323157
               YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekl.senedeevprv 112
                          vsvPs+sl+++vtvrCGhC +llsvn+  + q+l+ ++      k +l          ++s + +++s s+s++++    ++ ++e pr+
  Potri.009G000100.2  23 QVSVPSSSLLNIVTVRCGHCGNLLSVNMGASLQTLPLQDA----QKLHL----------INSEDLNKDSGSSSKPNKVTaFKSAEHEPPRM 99 
                         79**********************************9996....22222..........22223333333333333222135677889999 PP

               YABBY 113 ppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaa 157
                          p irPPekrqrvPsaynrfikeei+rika+nPdishreafs+aa
  Potri.009G000100.2 100 SP-IRPPEKRQRVPSAYNRFIKEEIHRIKACNPDISHREAFSTAA 143
                         99.9****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.4E-4721143IPR006780YABBY protein
SuperFamilySSF470956.28E-697139IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MNLTKMDEGW TNIPFKLYNS SWQVSVPSSS LLNIVTVRCG HCGNLLSVNM GASLQTLPLQ  60
DAQKLHLINS EDLNKDSGSS SKPNKVTAFK SAEHEPPRMS PIRPPEKRQR VPSAYNRFIK  120
EEIHRIKACN PDISHREAFS TAA
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:17216490}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.009G000100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1474021e-104EF147402.1 Populus trichocarpa clone WS01230_J05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024453770.11e-70axial regulator YABBY 5 isoform X4
SwissprotQ10FZ74e-42YAB2_ORYSJ; Protein YABBY 2
TrEMBLA0A2K1Z0D31e-102A0A2K1Z0D3_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0001s22180.14e-73(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-40YABBY family protein