PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G213500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 688aa    MW: 75225.4 Da    PI: 6.146
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G213500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.4e-29215268155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Potri.008G213500.1 215 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 268
                         79*******************.********************************8 PP

2Response_reg77.54.8e-26361441109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ + +l+++l+  +y ev+ +  +e al ll+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + 
  Potri.008G213500.1  36 VLVVDDDPTCLVILEKMLRTCRY-EVTKCNRAEIALSLLRENKngYDIVISDVHMPDMDGFKLLEQIGLEM-DLPVIMMSADDGKNVVMKG 124
                         89*********************.***************999999**********************6654.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Potri.008G213500.1 125 VTHGACDYLIKPIRIEALKN 144
                         ****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.3E-18210668IPR017053Response regulator B-type, plant
SuperFamilySSF521723.56E-3533158IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.5E-4233187No hitNo description
SMARTSM004482.2E-2934146IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.50535150IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.8E-2336144IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.04E-2637149No hitNo description
PROSITE profilePS5129410.737212271IPR017930Myb domain
SuperFamilySSF466895.02E-20213272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-30214273IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-25215268IPR006447Myb domain, plants
PfamPF002499.9E-8217267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MMNLANCKGS MSTATSGGVW KASDGASDQF PAGLRVLVVD DDPTCLVILE KMLRTCRYEV  60
TKCNRAEIAL SLLRENKNGY DIVISDVHMP DMDGFKLLEQ IGLEMDLPVI MMSADDGKNV  120
VMKGVTHGAC DYLIKPIRIE ALKNIWQHVV RKRKNEWKDL EQSGSVEEGG DRQQKQPEDA  180
DYSSSANEGS WKNSKRRKDE EEEAEERDDT SALKKPRVVW SVELHQQFVA AVNQLGIDKA  240
VPKKILELMN VPGLTRENVA SHLQKYRLYL RRLSGVSQHQ NGMGSSFISP QEATYGPLSS  300
LNGLDLQTLA TAGQLPAQSL ATLQAAGLGR STAKPRMPMP IVDQRNLFSF ENPKLRFGEG  360
QQQHLNNGKQ TNLLHGIPTT MEPKQLANLH HSAQSLGSMN MQFNAHAGQS SSLLMQMSQQ  420
QSRGQILNET THSHVPRLSS SIGQPIASNA LASGVLTRNG LAENGRGIGF NPVSQSSTLL  480
NFPLNTTAEL TATSFPLGSA AEVPSLTSKG TFQEEISSEI KGTGGFMPSY DIFSDLQQHR  540
SHDWELQNVG MTFNGSQQSN SVQSNLDVAP SVLSHQGFSS CQSNGQSRNN ISVVGKPMFS  600
AGDATEHVNA QSLEHPINTF FAENSMRVKT ERVPDANPQT ALFNGQFGQE DLMSALLKQQ  660
QQQQQGGIGL AENEFDFDGY SLDNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22211274164ARR10-B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:9891419}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G213500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081380.0FN908138.1 Populus x canadensis mRNA for putative B-type response regulator 12 (rr12 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463226.10.0two-component response regulator ARR2 isoform X1
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A2K1ZL330.0A0A2K1ZL33_POPTR; Two-component response regulator
STRINGPOPTR_0008s22990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]