PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G194400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 303aa    MW: 35004.3 Da    PI: 4.7813
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G194400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.3e-1980134357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         k++++t+ q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa+ k+
  Potri.008G194400.1  80 KKRRLTAAQVQFLEKSFEAENKLEPERKMQLAKELGLQPRQVAVWFQNRRARFKN 134
                         56689***********************************************995 PP

2HD-ZIP_I/II123.41.1e-3979170192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl++ qv++LE+sFe+e+kLeperK++la+eLglqprqvavWFqnrRAR+k+kqlE+dy++L+ ++d+lk++ ++L  e+++L++el
  Potri.008G194400.1  79 EKKRRLTAAQVQFLEKSFEAENKLEPERKMQLAKELGLQPRQVAVWFQNRRARFKNKQLERDYDSLRISFDKLKADYDKLLLEKQNLKNEL 169
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                          
  Potri.008G194400.1 170 L 170
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.64E-2065137IPR009057Homeodomain-like
PROSITE profilePS5007117.81575135IPR001356Homeobox domain
SMARTSM003898.8E-1878139IPR001356Homeobox domain
PfamPF000463.2E-1680133IPR001356Homeobox domain
CDDcd000861.66E-1680136No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2081142IPR009057Homeodomain-like
PRINTSPR000315.0E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000315.0E-6115131IPR000047Helix-turn-helix motif
PfamPF021834.0E-14135176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAGDKDCGSS KMTIFLRNGR LPPCESLCIL TSFSTLHGAK SMVNFRNDGG DTVDMSFFQP  60
HVKEESSDED YDAHLKPSEK KRRLTAAQVQ FLEKSFEAEN KLEPERKMQL AKELGLQPRQ  120
VAVWFQNRRA RFKNKQLERD YDSLRISFDK LKADYDKLLL EKQNLKNELL SLKEKLLSRE  180
ESMESSEPFD VIHSPDAELE PMPDTVSENV SAIVPMVTPK QEESSAKNDV FNSDSPRSFL  240
EPRDCYRVFE SDQPDFSQVE EDNLTRSFLP PPYFPKLYRE PPASSRNFEF SAEDQPFWSW  300
IF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARFKNKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G194400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002312706.30.0homeobox-leucine zipper protein HAT5 isoform X1
RefseqXP_024462665.10.0homeobox-leucine zipper protein HAT5 isoform X1
TrEMBLA0A2K1ZK220.0A0A2K1ZK22_POPTR; Uncharacterized protein
STRINGPOPTR_0008s19900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-33homeobox 3