PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G181000.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 523aa    MW: 58581 Da    PI: 5.6878
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G181000.9genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like254.3e-08128152125
             G2-like   1 kprlrWtpeLHerFveaveqLGGse 25 
                         k+r++W+ +LH++Fv+av+q+G   
  Potri.008G181000.9 128 KARVVWSVDLHQKFVKAVNQIGFDT 152
                         68*******************7554 PP

2G2-like38.52.6e-121721992855
             G2-like  28 tPktilelmkvkgLtlehvkSHLQkYRl 55 
                          Pk+il++m+v+ Lt+e+v+SHLQkYRl
  Potri.008G181000.9 172 GPKKILDMMNVPWLTRENVASHLQKYRL 199
                         5**************************8 PP

3Response_reg32.93.2e-1215653109
                         CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
        Response_reg  53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                         mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga d+l Kp+ ++el++
  Potri.008G181000.9   1 MPDMDGFKLLEQVGLEM-DLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELRN 56 
                         9************6644.8***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001561.67E-12162No hitNo description
PROSITE profilePS5011024.176162IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521722.56E-15177IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.3E-21179No hitNo description
PfamPF000723.8E-9157IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:1.10.10.604.9E-25126204IPR009057Homeodomain-like
SuperFamilySSF466893.05E-13126203IPR009057Homeodomain-like
PfamPF002493.6E-6130198IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.7E-10171199IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MPDMDGFKLL EQVGLEMDLP VIMMSVDGET SRVMKGVQHG ACDYLLKPIR MKELRNIWQH  60
VFRKKIHEVR DIETLERVES FQMTRNGSDQ YEDGHVLCGE DLTSIKKRKH IESKHDEKDT  120
GDSISTKKAR VVWSVDLHQK FVKAVNQIGF DTTSLPSFDG AMTGSVCLAE VGPKKILDMM  180
NVPWLTRENV ASHLQKYRLY LSRLQKENDF KNPAGGIKQS DSPLRDSAGS FGSQNSINLQ  240
HNDVSNGSYR FSGSSLVVHN GDPRSHDSDR KRLVSTPVEE PKRTLTVNVP NPCIPRSSQM  300
EFGHPLAPPQ SEVDFGALDS TFPTKYPWCG IPEIQLKKEH NPLHLNDEFS HLPLPGQKQL  360
TQADYPQPAP AISSAPSLTP SHNEYRSNVN HASSTAIAVD SSPIQTKTNV ANHQAIELIS  420
KSTPSLENQG FNMNSITEFE SSRKNINLGM LPFTTLEEDL QVCWVPGDCY MNLGLQNIEV  480
LEYFDPGLIT DVPVNLNDGL RFDYEFNDPT EYSLIDQSLF IA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G181000.9
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081450.0FN908145.1 Populus x canadensis mRNA for putative B-type response regulator 14 (rr14 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463385.10.0two-component response regulator ARR11 isoform X4
RefseqXP_024463386.10.0two-component response regulator ARR11 isoform X4
TrEMBLA0A2K1ZJ950.0A0A2K1ZJ95_POPTR; Two-component response regulator
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.14e-86response regulator 11