PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G181000.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 505aa    MW: 56840.1 Da    PI: 6.0356
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G181000.8genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.41.8e-24128181155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++W+ +LH++Fv+av+q+ G +k  Pk+il++m+v+ Lt+e+v+SHLQkYRl
  Potri.008G181000.8 128 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDMMNVPWLTRENVASHLQKYRL 181
                         68*******************.9*******************************8 PP

2Response_reg333.1e-1215653109
                         CTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
        Response_reg  53 mpgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                         mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga d+l Kp+ ++el++
  Potri.008G181000.8   1 MPDMDGFKLLEQVGLEM-DLPVIMMSVDGETSRVMKGVQHGACDYLLKPIRMKELRN 56 
                         9************6644.8***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001561.55E-12162No hitNo description
PfamPF000723.6E-9157IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011024.176162IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521722.42E-15177IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.2E-21179No hitNo description
SuperFamilySSF466891.52E-17126185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-28126186IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-21128181IPR006447Myb domain, plants
PfamPF002496.3E-8130180IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MPDMDGFKLL EQVGLEMDLP VIMMSVDGET SRVMKGVQHG ACDYLLKPIR MKELRNIWQH  60
VFRKKIHEVR DIETLERVES FQMTRNGSDQ YEDGHVLCGE DLTSIKKRKH IESKHDEKDT  120
GDSISTKKAR VVWSVDLHQK FVKAVNQIGF DKVGPKKILD MMNVPWLTRE NVASHLQKYR  180
LYLSRLQKEN DFKNPAGGIK QSDSPLRDSA GSFGSQNSIN LQHNDVSNGS YRFSGSSLVV  240
HNGDPRSHDS DRKRLVSTPV EEPKRTLTVN VPNPCIPRSS QMEFGHPLAP PQSEVDFGAL  300
DSTFPTKYPW CGIPEIQLKK EHNPLHLNDE FSHLPLPGQK QLTQADYPQP APAISSAPSL  360
TPSHNEYRSN VNHASSTAIA VDSSPIQTKT NVANHQAIEL ISKSTPSLEN QGFNMNSITE  420
FESSRKNINL GMLPFTTLEE DLQVCWVPGD CYMNLGLQNI EVLEYFDPGL ITDVPVNLND  480
GLRFDYEFND PTEYSLIDQS LFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-17125186263ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G181000.8
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081450.0FN908145.1 Populus x canadensis mRNA for putative B-type response regulator 14 (rr14 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463384.10.0two-component response regulator ARR11 isoform X3
TrEMBLA0A2K1ZJ900.0A0A2K1ZJ90_POPTR; Two-component response regulator
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.12e-89response regulator 11