PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.008G181000.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 578aa    MW: 65091.6 Da    PI: 5.9383
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.008G181000.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.22.1e-24201254155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++W+ +LH++Fv+av+q+ G +k  Pk+il++m+v+ Lt+e+v+SHLQkYRl
  Potri.008G181000.5 201 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDMMNVPWLTRENVASHLQKYRL 254
                         68*******************.9*******************************8 PP

2Response_reg80.36.3e-27211291109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+k  y ev+++  +++al+ll+e++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++  ge + + + 
  Potri.008G181000.5  21 VLVVDDDPTWLKILEKMLKKCSY-EVTTCGLARDALNLLRERKggYDIVISDVYMPDMDGFKLLEQVGLEM-DLPVIMMSVDGETSRVMKG 109
                         89*********************.***************999999**********************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ ++el++
  Potri.008G181000.5 110 VQHGACDYLLKPIRMKELRN 129
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.9E-1451517IPR017053Response regulator B-type, plant
SuperFamilySSF521721.71E-3518150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.8E-4418152No hitNo description
SMARTSM004482.5E-3219131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.53320135IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.6E-2421130IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.08E-3022135No hitNo description
Gene3DG3DSA:1.10.10.601.0E-27199259IPR009057Homeodomain-like
SuperFamilySSF466893.76E-17199258IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-21201254IPR006447Myb domain, plants
PfamPF002497.5E-8203253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MMENNGFSSP RNDSFPAGLR VLVVDDDPTW LKILEKMLKK CSYEVTTCGL ARDALNLLRE  60
RKGGYDIVIS DVYMPDMDGF KLLEQVGLEM DLPVIMMSVD GETSRVMKGV QHGACDYLLK  120
PIRMKELRNI WQHVFRKKIH EVRDIETLER VESFQMTRNG SDQYEDGHVL CGEDLTSIKK  180
RKHIESKHDE KDTGDSISTK KARVVWSVDL HQKFVKAVNQ IGFDKVGPKK ILDMMNVPWL  240
TRENVASHLQ KYRLYLSRLQ KENDFKNPAG GIKQSDSPLR DSAGSFGSQN SINLQHNDVS  300
NGSYRFSGSS LVVHNGDPRS HDSDRKRLVS TPVEEPKRTL TVNVPNPCIP RSSQMEFGHP  360
LAPPQSEVDF GALDSTFPTK YPWCGIPEIQ LKKEHNPLHL NDEFSHLPLP GQKQLTQADY  420
PQPAPAISSA PSLTPSHNEY RSNVNHASST AIAVDSSPIQ TKTNVANHQA IELISKSTPS  480
LENQGFNMNS ITEFESSRKN INLGMLPFTT LEEDLQVCWV PGDCYMNLGL QNIEVLEYFD  540
PGLITDVPVN LNDGLRFDYE FNDPTEYSLI DQSLFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-17198259263ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.008G181000.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN9081450.0FN908145.1 Populus x canadensis mRNA for putative B-type response regulator 14 (rr14 gene), cultivar Dorskamp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463384.10.0two-component response regulator ARR11 isoform X3
TrEMBLA0A2K1ZJ910.0A0A2K1ZJ91_POPTR; Two-component response regulator
STRINGPOPTR_0008s18130.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-131response regulator 11